GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:47:19

Sequence TGIF2LY_1 : 3354 bp : 41.71% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1361   1807  447  1  0   57  -13   564 0.781  37.21
ataaccagctcggctgttagcaactctgttagcaaagctgtttgtctttctcggaaacaa
caggtgagaattccccttacagacctgcccatgctttctaaagtggctctcccaaaccta
cctttgtcctaactcagttgtctgtgattctcaatatagtaacgataagcctctttgaat
ATGGAGGCCGCTGCAGACGGCCCGGCTGAGACCCAAAGCCCGGTGGAAAAAGACAGCCCG
GCGAAGACCCAAAGCCCAGCCCAAGACACCTCAATCATGTCGAGAAATAACGCAGATACA
GGCAGAGTTCTTGCCTTACCAGAGCACAAGAAGAAGCGCAAGGGAAACTTGCCAGCCGAG
TCCGTTAAGATCCTCCGCGACTGGATGTATAAGCATCGGTTTAAGGCCTACCCTTCAGAA
GAAGAGAAGCAAATGCTGTCAGAGAAGACCAATTTGTCTTTGTTGCGGATTTCTAACTGG
TTTATCAATGCTCGCAGACGCATTCTCCCGGATATGCTTCAACAGCGTAGAAACGACCCC
ATCATTGGCCACAAAACGGGCAAAGATGCCCATGCCACCCACCTGCAGAGCACCGAGGCG
TCTGTGCCGGCCAAGTCAGGGCCAGTG
gtccagacaatgtacaaagcctgcccctgtggcccttgccaaagggccagatgtcaagag
agaagcaaccagatccggagtcggcccctagccagaagctcaccggaatagcccagccaa
agaaaaaggtcaagatttctatcacttccccgtcttctccagaacttgtgtctccagagg

 1.02 Term +   1852   2085  234  0  0   36   38   391 0.855  24.24
tcgcagacgcattctcccggatatgcttcaacagcgtagaaacgaccccatcattggcca
caaaacgggcaaagatgcccatgccacccacctgcagagcaccgaggcgtctgtgccggc
caagtcagggccagtggtccagacaatgtacaaagcctgcccctgtggcccttgccaaag
GGCCAGATGTCAAGAGAGAAGCAACCAGATCCGGAGTCGGCCCCTAGCCAGAAGCTCACC
GGAATAGCCCAGCCAAAGAAAAAGGTCAAGATTTCTATCACTTCCCCGTCTTCTCCAGAA
CTTGTGTCTCCAGAGGAGTACGCCGACTTCAGCAGCTTCCTGCTGCTAGTCGATGCAGCA
GTACAAACGGCTGCCGAGCTGGAGCTAGAGAAGAAGCAAGAGCCTAATCCATGA
ttgatgatgttccaaaaacccaagtagtcagtcccttgtgtactgtggtaaacctgttta
tgttcaccccaacttatttgtatgcttatcttttatagaggcatctttctttctactggt
tttatgagtaccaatcttaattattgggactaaattctgtcagatatttcagtgtttcca

Predicted peptide sequence(s):


>TGIF2LY_1|GENSCAN_predicted_peptide_1|226_aa
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAE
SVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDP
IIGHKTGKDAHATHLQSTEASVPAKSGPVGQMSREKQPDPESAPSQKLTGIAQPKKKVKI
SITSPSSPELVSPEEYADFSSFLLLVDAAVQTAAELELEKKQEPNP