GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:53:09

Sequence CD99_1 : 52520 bp : 47.60% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1375   1441   67  0  1  110   88   248 0.995  26.23
gcgcgtggaggccggggcggggcgggcgcagccggcgctgagcttgcagggccgctcccc
tcacccgcccccttcgagtccccgggcttcgccccacccggcccgtgggggagtatctgt
cctgccgccttcgcccacgccctgcactccgggaccgtccctgcgcgctctgggcgcacc
ATGGCCCGCGGGGCTGCGCTGGCGCTGCTGCTCTTCGGCCTGCTGGGTGTTCTGGTCGCC
GCCCCGG
gtgagcgagcggagggatccgggttgggggacgcggagggcgcgggccgggactggggat
ccgcttgagatgcggcgttgggggcgccccgcggggacacccggagcctcctccctgccc
ggcaggacgcgctgtgcccacgggggcccaggcccggaggaggcgcccactttctcccca

 1.02 Intr +  24436  24468   33  2  0  114  105    15 0.831   3.99
cttttaggcatggaagtgaatatttagaatgagaagagaaatcacgcaccttgtaaattt
ttttaagttgctgttttaaatatcacaaaaagaaaaatcgcatatcttttttatctctat
aatattcaaatttatttttatttttcttgtttctaagttgactctttttttctctcttag
ATGGTGGTTTCGATTTATCCGATGCCCTTCCTG
gtgagtatcaacatcattttttaaaatcccgtcaatattttatgttaacatagtatatac
aggcatatcccagccatttccagctaggttctagaccaccgcaataacaggagtcatagc
aatttttggcttcccagtacatataaatgttatgtttactctcaactgtagtctattaag

 1.03 Intr +  29675  29719   45  0  0  108  101    57 0.986   7.38
agaatagtgatgtaaaaatggtcaggaattcactttttctaatgagatcctggtcaagct
gatattcagaaaagtatttaggaatgtggggccgtggtgtgtttttgatctgttcacgag
gtcattccttcctcgtttctctctggaatttggtattaactgctctttcccctcttttag
GGGATGACTTTGACTTAGGAGATGCTGTTGTTGATGGAGAAAATG
gtgagtattttcctttaatctcttctgctgctgatctgcttattatcacccaattatgat
catttcagagagaattctcccatttaaattataaagggaaccagttttcacagtggaaac
ctagggaataggtgtgtcggtttgttcttgctgttgtcgttgggtttttctttacaacca

 1.04 Intr +  30370  30438   69  2  0   57  111    61 0.947   4.45
gaactgtggctgaaagttgatgggaggaaactggcaggagactgtgtgtgtacaggtatc
cccaccaggacaaaggccaaggtccaatttctgttcagggaaccatctgtgtgtaaactg
atgtttcattttctttactgcaaggcacttaaaattgcaactctcatctttcacaaacag
ACGACCCACGACCACCGAACCCACCCAAACCGATGCCAAATCCAAACCCCAACCACCCTA
GTTCCTCCG
gtaagagtctctgaccctgtgggatgtcttcatgttgttcagaattcagcgatatttatg
tcagctgagaggaggtgatttcagatgagtgtgtgcttactgttgactgcctgtgcagtg
taatgcccatgttcatgtaatggaaaatgtacatttcaaaaatatatatttagcttggat

 1.05 Intr +  32641  32688   48  2  0  116   87    37 0.915   5.05
agtagctgggattacatgtgcctgtcaccacatccagctaatttttatattcttagtgga
gatggggtttcaccatgttgatgaacaggccggttttcatgagtttttcctttattctaa
gacatgaagacccttggaggagttccaggttgacaggtgatgctgtattttctttcctag
GTAGCTTTTCAGATGCTGACCTTGCGGATGGCGTTTCAGGTGGAGAAG
gtacagttatcttgttttctgtctcttttctctctccatcccatgatgcccacctgctct
gtagaatcactacagggtctaaactgtcagctctctgtgaactcacagtgaaatgttcag
ccatctctgtgggaactccgcctgtttgctgaggcttcaaggatgtgggaagtaaaggct

 1.06 Intr +  36274  36387  114  2  0  104  115    95 0.963  14.22
tttgccttcctgtgtatcattctcggcatgcttcctttgcaaatcggtcagctcaggcgt
ctgagatgttctgaggatcttggtgctctcagactgactgtctctgccagccactgcccc
ctgggatcttctctgcaccgtgcgtgtctcaatcacgatgctgtgtgcttcctcctgcag
CCGACGCCCCAGGCGTGATCCCCGGGATTGTGGGGGCTGTCGTGGTCGCCGTGGCTGGAG
CCATCTCTAGCTTCATTGCTTACCAGAAAAAGAAGCTATGCTTCAAAGAAAATG
gtaagtctcagtccgccggtgcctctccttcatgccttgctgattggaaaactgtgcttt
ctttaaaaggcagaaaccaaactcgggctggcacgaaacaggtgcacgatggctgatggt
tcgtgaaactgctaaaattctggaatcgaaccttctggctttgatttcagggctgttctg

 1.07 Intr +  48214  48270   57  2  0  107   99    86 0.841  10.46
cttcacttacatgagtgttagactccatgttcccagtgggtctcggggttcagaactgag
tgctctcatccaagcaataggagcgtcgacctcaggaaagcccaagtgttttgtgtgtat
tttgaggagtgggttatctgttgcactgagcctctctgtgtattttcttcttcttttcag
CAGAACAAGGGGAGGTGGACATGGAGAGCCACCGGAATGCCAACGCAGAGCCAGCTG
gtaagaaggacggggaacgatggcttgcacacgtggccagtgttcccattttatcttctc
catcctctcccatcttgctgtcctgctcacattctcaaatttggttgcatggctttgaat
gtcttcctttatgtctcgttgctttggagggatactttcaaaagacaatgaatgtgtaaa

 1.08 Intr +  50697  50740   44  1  2   80   94    -4 0.439  -2.64
atttgttagtgtctctgtgacgtcgttagtggaaattgccttctgctgttttccttctgc
tttttctgcagcatccattttttttaatgaatggcatcattcaatgaaattgattgaatt
gattgagatttagggttttgctttctcgtgatgagttttgggcccatttttcttatgcag
AAATAAAACCACTGGCTCCTGAAAGTTGTAGGAACTGTGTCCAC
gtgagtgctcagggacctgggaatgactttcttttgtctctgtctcccacagttcagcgt
actcttttagagaaatagaagattgtcggcagaaacagcccaggcgttggcagcagggtt
agaacagctgcctgaggctcctccctgaaggacacctgcctgagagcagagatggaggcc

 1.09 Intr +  51149  51231   83  1  2   81  121     3 0.421   1.34
tgttgctgggcggatgatgtttactaacgatgaattttacatccaaagggggataggcac
ttggacccccattctccaaggcccgggggggcggtttcccatgggatgtgaaaggctggc
cattattaagtccctgtaactcaaatgtcaaccccaccgaggcacccccccgtcccccag
AATCTTGGCTGTTTACAAATCACGTGTCCATCGAGCACGTCTGAAACCCCTGGTAGCCCC
GACTTCTTTTTAATTAAAATAAG
gtaagcccttcaatttgtttcttcaatatttctttcatttgtagggatatttgtttttca
tatcagactaataaaaagaaattagaaaccaagtacttttttttttttacttaaatattt
tgccgtgggtggatgttaaagaaggccgtggtaatttacaggatgggttccaagttctct

 1.10 Term +  51638  51749  112  2  1   61   47   135 0.223   4.73
tatttccaaaatgtccttgttgggctcttttcctttcccgtgtcctgccacatcgggatg
ggtactcttctgcacccagatactcccagccagatactctcctccatccagatactctgt
ttccagatactctccctgcagctagttatccccttgagtccagatgctgcctgcttccag
ATACTCCTCTGTATCCAGATACTCCTCTAAATCCAGGTACTCCCTACATCCAGATACTGT
ACTTCCTAAGATGTACAAGATGTACCGCATTTTCCCAACACTGAAGACTTGA
ccacagcttaagtgggttggttaaatacattatggcccagattgcaatggatcttctgcc
ttgttaaaaagaatgaatgagtcaagggtctttttgtttactgacactgcctagcatgta
ttgaagctcagtaaacacttgcagaataaatcacagaaaagcctctctccttaagaagtt

Predicted peptide sequence(s):


>CD99_1|GENSCAN_predicted_peptide_1|223_aa
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPGDDFDLGDAVVDGENDDPRPPNPPKPM
PNPNPNHPSSSGSFSDADLADGVSGGEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKL
CFKENAEQGEVDMESHRNANAEPAEIKPLAPESCRNCVHNLGCLQITCPSSTSETPGSPD
FFLIKIRYSSVSRYSSKSRYSLHPDTVLPKMYKMYRIFPTLKT