GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:15:17

Sequence TREX2_1 : 28267 bp : 56.36% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1338  138  0  0   67   48   291 0.814  21.11
cgcttcactgtggtcctgcctctgggtggtgccggggcggggggtgggagcccggggccc
gcgcaggcggagatgtcgcccaatgggaagggtcggtcgggaagggggtgggcgcaggcg
ggtgggcgggaagaacgctggaggttgattggcggtcttgccggccagtgaagccagggc
ATGGGCGGGGCGCGGCTCGGAGCGCGAAACATGGCGGGGCAGGACGCTGGCTGCGGCCGT
GGCGGCGACGACTACTCAGAGGACGAGGGCGACAGCAGCGTGTCCAGGGCGGCTGTGGAG
GTGTTCGGGAAGCTGAAG
gtgctgttggcccagaaagccactccagggcgggggaccggggagggccccgcccgaggc
ccgggagggcttgctgcggaagtccgcggcgccacgcggccaccgtcgccggttccggct
gcgccctgttcccttgcagcagggggtgcttgtggatcattcatctttgccctttggtgt

 1.02 Intr +   2527   2642  116  0  2   84   52    99 0.833   5.65
aggcaggagaattgctggaacccaggaggtggaggctgcagtgagccgagatcatgccac
tgcactccatccaggctgggcgacagagtgagactccgtctcaaaaataaataaataaat
aaaatgaaatgatgtacactgggactttcagtgaatgttgctttccttttccttgcttag
GACCTAAACTGCCCCTTCCTCGAGGGTCTGTATATCACAGAGCCAAAGACAATTCAGGAA
CTGCTGTGCAGCCCCTCAGAGTACCGCTTGGAGATCCTAGAGTGGATGTGTACCCG
gtaatgcatcagtttcttcctcttcccacctggggtgtgcatgggcgccagccagcccca
cctggggaagatggggtttgtggttactgtgagtagctgtcttcccagagggctccaccc
cctagcctggaccctcgtgagaacagctgtgtaggtaaggagtactggtgacaggcatga

 1.03 Intr +   6165   6287  123  0  0   67   43    67 0.447   0.31
ttgggctgtgctcccctgaaggaggagacccagtggagggctgagccgtgtgtcacctgt
ggtgcatgtctgggtgtcgtgggacttcctgccttccatgcgctgtgcatgtggatctgg
ttttgcccaccagatggcttttaaggtgacatgcttctgagcggcccctgtgtgctgcag
TCAAGGGCAAGCCTTCACCGTGCCCAAGGTGATGAGCCTCGACTGTGACCACAGACTCTG
TTGCGGCAGGAGCCCCCACATGACTGAATGCAGGCCTCACAAGCCTTTTCTGCAGAGGGC
CGG
gtgggaagaaagttttccaccctggagcagttgatgccgacccaggcgaggccggggagg
gtgccaggagcccggggccagccctcaaaacccacccgctgcgccatttcgagaaagagc
cctgagtgctggcagcttccctctctgcctctgctgcagccatctttttttttttttttt

 1.04 Intr +   6733   6800   68  1  2  128  100    14 0.807   5.64
ttctttccctaataattaatggaaatgaaatccacgtgacacagaagtaaccactttaaa
gtgagccgctccgtgccgttgagcacgtgcacaggaattcacttcttccagcgcgtatag
agggcccagggggattctctggctgtctccggcctgaccagctctgctgtttccctgcag
GGTCTGGCCCTCACTGCAGGACAGGTTCAGCTCACTGAAAGGGGTCCCAACAGAGGTGAA
GATCCAAG
gtaggtggaatcttggtccattctgagcttgtccacagcctccttatggagtggtggtgc
atgttccattggaccaacgttttcttttaggtggtgcatgttgtgtggatgttgctagag
ccttcttgaaccccacccttccctaggcatggcaggtgggagaactcctctcgcagggac

 1.05 Intr +   9117   9178   62  1  2   84  116    82 0.905   9.54
gcccagagaggggtggggccactcagcaagaggcagcgctggcacctgggtgcctgcctc
ctggcccaccctggtctcctatacccagtctagtctgtgggtgctgggcttcctgggtgt
ctgctgtcccctgctgtctgggcaggtgcctgccatgatgggctctttgtgtttcaacag
AAATGACGAAGCTGGGCCACGAGCTGATGCTGTGTGCGCCAGATGACCAGGAGCTCCTCA
AG
gtaagagggcctctgtctgctctgcagacggcacgcacgctttctgccctgggcagggaa
cctcatggtgctggctgaggtgggaggattttcctcccctagtgcctttgaggttcctca
ggccctggggccggctgggtgcccgggcaggctgcttctctaggcatccctggggccaga

 1.06 Intr +  13410  13508   99  2  0   43   47   100 0.472   2.21
agcgtccatagaagtgttattcttaatggcctgaaagtggaaagagcccaaatgtccatc
agctggtgaatgtataaactaactagcaataaaaaggaaatcaactactcatctgcgctg
ggacacgcgtgatcctcgccagcctcatgcttggtagtgtatgattccattgctgtgcag
CATGTAGATAGGCCAGGTCAGTGCTGTGGGGACGTGGCAGCCCGCTGCCCCCAGATCACC
TTGGAGCACATGACTGTGGTCAGCACCACCGTGCAGGCA
gtgagccctcccagtgccatcgcccctgtcctgggtgccctgagcttctcgcacctgtgc
tcctgaatctgcctcagttggatgtcatggtgatgcccaggctctatgctattggcagtg
ttgccaattttaccttatcattgcccccgcctgccacacacttttctgaggaatgcacca

 1.07 Intr +  14560  14651   92  0  2   71   88   113 0.986   8.89
gcagggagcacttgctagtccaagacattgctgggcaggcacagggtcgttgatgggcca
ggcccctcctttcccctggctcctggcatgggtggcatgtgggggcaggggcactgggga
cagctggccttggcctggcttagatggagccagtgaatgtctgtggtcttccttgcccag
GGCTGTGCCTGCGCCCAGAAGCAGCTACACTTCATGGACCAGTTGCTCGATACCATCCGG
AGCCTGACCATTGGGTGCTCCAGTTGCTCGAG
gtaaaggtgtggatggcccaggtgggcagtattgacgggcttctcttggtcctagttctg
gagctggtaggggctggggtgtcactccccctctgatgctggctggggtgtgacacccca
cttggggatctggctggccaatcaggggccgggcagcatacgggcaaggggcagctgtgt

 1.08 Intr +  15137  15295  159  2  0   52   76   252 0.999  20.02
aggcgggcaaaaatggaggagccagggcagacaggtggggcaggattctgcgcggtgggg
cttgtcctggcctctgtgcctggccccgatgtgcttctggggccttccctgtggggctga
gggcctgctgggcgagtgctctggcctgtgacggtgtggccctgggggctgcctttgcag
CCTGATGGAGCACTTCGAGGACACCAGGGAGAAGAACGAGGCCTTGCTGGGGGAGCTCTT
CTCTAGCCCCCACCTGCAGATGCTCCTGAATCCAGAGTGCGACCCGTGGCCCCTGGACAT
GCAGCCCCTCCTCAACAAGCAGAGTGATGACTGGCAGTG
gtacgtgctcctggaggcctcagtggcagcaccctggcctcctgtcccagccccaggctg
cttggttctgttactgcagacacccctggcagcggtgagttgcaagtgttccctttctct
ccctgcagggccagtgcctctgccaagtccgaggaggaggagaagctggcggagcttgcc

 1.09 Intr +  15424  15523  100  1  1  122   78   165 0.977  19.51
ggcccctggacatgcagcccctcctcaacaagcagagtgatgactggcagtggtacgtgc
tcctggaggcctcagtggcagcaccctggcctcctgtcccagccccaggctgcttggttc
tgttactgcagacacccctggcagcggtgagttgcaagtgttccctttctctccctgcag
GGCCAGTGCCTCTGCCAAGTCCGAGGAGGAGGAGAAGCTGGCGGAGCTTGCCAGGCAGCT
GCAGGAGAGTGCTGCCAAGTTGCACGCGCTTAGAACGGAG
gtgagggtgctagctcctgggagggggttgcttggaggcaaggccctgctttgtcacctc
cctcagcacgtgaggcttaggcgaggttgcctgtgcaccgggcctgacatgttctagaat
actgtggtgctcagtccgcggggaggtgagaggtgggtcccgtggctgggggaagggatc

 1.10 Intr +  16022  16246  225  1  0   69   80   265 0.956  22.51
gctgaggctgggagccagaaggtcttgctctggcctgagtcgctcggtacagctcccctg
tgtccctgtttctgaaagctttcttcctcgccctgggtgtgcagtgtctgaggtgagggc
cggtggcagcctggctggtgggcagggcagcctcaagggactctgcctctggctttgcag
TACTTTGCACAGCATGAGCAAGGGGCTGCTGCGGGCGCAGCCGACATCAGCACCCTAGAC
CAGAAGCTGCGTCTGGTCACTTCCGACTTCCACCAGCTAATCTTGGCTTTTCTCCAAGTC
TACGACGACGAGCTGGGCGAGTGCTGCCAGCGCCCAGGCCCTGACCTCCACCCGTGCGGC
CCCATCATCCAGGCCACGCACCAGAATCTGACTTCCTACAGCCAA
gtaagggtgcccttcccctcccctctaaccgccccctcccctgttcactcagactgagag
cttatatcctgcttgggctcaggggcctcagcagcccctgacaagggaccacagggcagg
accaggggctgggaggggctgggctgggctccctgctggccagtggcgtggcagggctct

 1.11 Intr +  17280  17394  115  2  1  141   84   236 0.999  29.02
attggtgacttccccgctgggagttctgtccctcacccttggctgtctttcaggtgaatg
ccacctgatcagtgtgagtgggggtgggaagcaggagatgccgtcgctacgtgagaccag
cggcatttagtgcctgctcgctccctccctccctccctccctccctccctccctccccag
CTGCTGCAAGTGGTCATGGCAGTTGCTGACACCTCTGCGAAGGCCGTGGAGACCGTGAAG
AAGCAGCAAGGCGAGCAGATCTGCTGGGGTGGCAGCAGCTCCGTCATGAGTCTAG
gtacgtggctgcccacctggccctctgcctggggctgccccacgcacaggcttccttttc
tgtgctccactagccctggaggagcatttggggaccggccccttcttttgtttttcattt
tctaatgcatgttttccttcacttgaaaaaatgctttcagcggattatcaaatgaaaacg

 1.12 Intr +  21000  21086   87  1  0   72   84    35 0.258   1.94
ctggacacaccagagaaagggtcagcatcaaatccacgccaaaggccactcgggacagtt
ctttatttgtcccgtttcccatctgaccccttgagggccgtggtctcgatggccctcctc
ccgctgtggaaggccgtgtttctgtgctgtttcacctcccagcgatctgcatgcccgcag
CCAGGCTCTGTTGGAGGTGCGGCACCACCTATGAAGTGAGGAGCAGCCAGTGTGCCTTCT
GGGCTCTTGCTGGGGGCATGGCCTCAT
gtgagttgggagggccttggcactgtggatcagcaccacacaccaggagtcgccccccag
gcttcctgaaacctcactgccatgaaaacatcaatgtatttagaaaccgaagcaatgctg
tcagtgcaagaatgggacaggagagttgagggtaccaacagtggagagatgccaccaacc

 1.13 Intr +  25740  25779   40  1  1   30  115    27 0.109  -2.63
tgcttcctaatttgtaaacacggggcgtgtgtctcagtggctgtgagctagcgagggggt
ggcgagcgagccggctgcgcaggtcctgaggccccaggcctcattgttggccaacaggca
gctgggggcgggctgcggccgctgattaaaggccgcctagagcagcctgtgtggcgacag
GTGCCCAGAAGCCCAGGAAGCCGGTCAGTGCCCGCCCCAG
gtaagctggtgtggtggggttggcaaggacagtctccccgggagcctgggggcaagcagg
cagaggccagctcgggaccagcacctgtgtgccagggacaagggtggggaggtcgagccc
agcgggagctgggtgcactgcatgggctctttcgggtggctgcttgcctgcttcccggca

 1.14 Term +  26324  27068  745  2  1   75   53  1042 0.328  92.78
taggtgacaggagtggggctgacgctcccagagccaaaggtcacaggtgctgtggtcggg
ggtggcaggaagtgagccccagaagggtcagagctttggctagggggaggatggtacaca
gcagggcccgggcgaacccctctctccagtcctcagggtttgtgcctctcgctcggacag
TTTGAGGACTTGCTATCCCCGTGGGAACATCACCATGTCCGAGGCACCCCGGGCCGAGAC
CTTTGTCTTCCTGGACCTGGAAGCCACTGGGCTCCCCAGTGTGGAGCCCGAGATTGCCGA
GCTGTCCCTCTTTGCTGTCCACCGCTCCTCCCTGGAGAACCCGGAGCACGACGAGTCTGG
TGCCCTAGTATTGCCCCGGGTCCTGGACAAGCTCACGCTGTGCATGTGCCCGGAGCGCCC
CTTCACTGCCAAGGCCAGCGAGATCACCGGCCTGAGCAGTGAGGGCCTGGCGCGATGCCG
GAAGGCTGGCTTTGATGGCGCCGTGGTGCGGACGCTGCAGGCCTTCCTGAGCCGCCAGGC
AGGGCCCATCTGCCTTGTGGCCCACAATGGCTTTGATTATGATTTCCCCCTGCTGTGTGC
CGAGCTGCGGCGCCTGGGTGCCCGCCTGCCCCGGGACACTGTCTGCCTGGACACGCTGCC
GGCCCTGCGGGGCCTGGACCGCGCCCACAGCCACGGCACCCGGGCCCGGGGCCGCCAGGG
TTACAGCCTCGGCAGCCTCTTCCACCGCTACTTCCGGGCAGAGCCAAGCGCAGCCCACTC
AGCCGAGGGCGACGTGCACACCCTGCTCCTGATCTTCCTGCACCGCGCCGCAGAGCTGCT
CGCCTGGGCCGATGAGCAGGCCCGTGGGTGGGCCCACATCGAGCCCATGTACTTGCCGCC
TGATGACCCCAGCCTGGAGGCCTGA
gcaccagggccacctcctgtgccatggacagtgccagcctccaccgttcagctggcctct
accacccccggctcctcctatctgggcagcctcaggtccgtgcacctgccaggccttccc
tggctgcctgaccagccatacggccctggattcctctccaggccccgcttccagggccgt

Predicted peptide sequence(s):


>TREX2_1|GENSCAN_predicted_peptide_1|722_aa
MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITE
PKTIQELLCSPSEYRLEILEWMCTRQGQAFTVPKVMSLDCDHRLCCGRSPHMTECRPHKP
FLQRAGVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKHVDRPGQCCGD
VAARCPQITLEHMTVVSTTVQAGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFED
TREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLA
ELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVY
DDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQ
ICWGGSSSVMSLARLCWRCGTTYEVRSSQCAFWALAGGMASCAQKPRKPVSARPSLRTCY
PRGNITMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLP
RVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICL
VAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGS
LFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSL
EA