GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:48:42

Sequence TFE3_1 : 17149 bp : 52.08% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1439   1554  116  1  2   78   80   163 0.966  14.20
cgggggatgactcacagcccatcccatctcccagacgccgcccgcccgcgcagtgctagc
tccatggcttagcggaggaggcggcagtggcgagctggggggaggggggactcttatttt
gttagggggaccgggccgaggcccgaccggcctggcagggctcgcccggggccgggcgtc
ATGTCTCATGCGGCCGAACCAGCTCGGGATGGCGTAGAGGCCAGCGCGGAGGGCCCTCGA
GCCGTGTTCGTGCTGTTGGAGGAGCGCAGGCCGGCCGACTCGGCTCAGCTGCTCAG
gtgcggggccgcctggggctgggagtgccgactggggctcccaggggcctgatctcgggg
gcagcgggggccccggactgggattggaggccctcggcctagccttggaggacgtcgggg
cgcccgtcttgggggggcacctaaggaatccggcagtggcctgcttggattgtggcttta

 1.02 Intr +   4096   4209  114  1  0  111   95    96 0.999  12.67
gatgggggaaggaggtgggaattcatggtggtgtggtacccagcaaggtggccaaatatg
aggggcttgtaccctcctcttcgttctcccccgctctctgtctctttctctgtctcaggg
gagggctggggaataaggtccttcattcaatcactgaccaccactccacctccccctcag
CCTGAACTCTTTGCTTCCGGAATCCGGGATTGTTGCTGACATAGAATTAGAAAACGTCCT
TGATCCTGACAGCTTCTACGAGCTCAAAAGCCAACCCTTACCCCTTCGCTCAAG
gtatgtatgacttgtctatctgattcccctcccaattcctcagccctcctctcccctctt
gatgggcagaggccctcagtaccagcccaacccattctttcaccagcctgcgttttctag
tggtggtaaaattagggaccagaaagagcatgtcacacaggaaagtaggtggccaagcta

 1.03 Intr +   5256   5559  304  0  1   70  116   112 0.794   9.34
ctgtgacccctgagagccatcaccaagcctggttcctgtgtctctgcttctacattgtgg
cctcggaaggcagagaacaggcctggttcctgtgtctgctccgtcacgctaagacccttt
aggcttgggatgagacttttagcttacctaaaatatggccccatatttcccattccacag
CCTCCCAATATCACTGCAGGCCACACCAGCCACCCCAGCTACACTCTCTGCATCGTCTTC
TGCAGGGGGCTCCAGGACCCCTGCCATGTCGTCATCTTCTTCATCGAGGGTCTTGCTGCG
GCAGCAGCTAATGCGGGCCCAGGCGCAGGAGCAGGAGAGGCGTGAGCGTCGGGAACAGGC
CGCCGCGGCTCCCTTCCCCAGTCCTGCACCTGCCTCTCCTGCCATCTCTGTGGTTGGCGT
CTCTGCTGGGGGCCACACATTGAGCCGTCCACCCCCTGCTCAGGTGCCCAGGGAGGTGCT
CAAG
gtaaggtgagatccagaggccctgggagggggctcctggtgactgaggagtgatcctagg
agctagggatggcctcgatgcactggtgatttgggggcaaggtcttaggggctctaagga
aggtccctggtactgtttaaattatctgtgttcatgtctcatgtgttttgggtttctgag

 1.04 Intr +   6224   6469  246  1  0  123   94   267 0.995  28.99
gtttgggtcctgggggagactcgctaatatttttggggtgttctcagattctgggcccag
cttgtctgcgtgagtctaggcaccaatgagttaggagggtcaggctggggctcagaattc
acccctttgagtcctgttctgccttgtcccctctctttccttgtctaccttatttcacag
GTGCAGACCCATCTGGAGAACCCAACGCGCTACCACCTGCAGCAGGCGCGCCGGCAGCAG
GTGAAACAGTACCTGTCCACCACACTCGGGCCCAAGCTGGCTTCCCAGGCCCTCACCCCA
CCGCCGGGGCCCGCAAGTGCCCAGCCACTGCCTGCCCCTGAGGCTGCCCACACTACCGGC
CCCACAGGCAGTGCGCCCAACAGCCCCATGGCGCTGCTCACCATCGGGTCCAGCTCAGAG
AAGGAG
gtaagaggctacagccaaacctcctcccacattcccctcccaaattcttctaaacctgta
taatatttacttcttcccctagattgatgatgtcattgatgagatcatcagcctggagtc
cagttacaatgatgaaatgctcagctatctgcccggaggcaccacaggactgcagctccc

 1.05 Intr +   6552   6656  105  2  0   99   89   120 0.999  14.11
tgcctgcccctgaggctgcccacactaccggccccacaggcagtgcgcccaacagcccca
tggcgctgctcaccatcgggtccagctcagagaaggaggtaagaggctacagccaaacct
cctcccacattcccctcccaaattcttctaaacctgtataatatttacttcttcccctag
ATTGATGATGTCATTGATGAGATCATCAGCCTGGAGTCCAGTTACAATGATGAAATGCTC
AGCTATCTGCCCGGAGGCACCACAGGACTGCAGCTCCCCAGCACG
gtgaggccctgagatgggaggttggtctgaaaattagggcatttctgtatcaccaagacc
atactcagtctggctgtgtgtataggagacccttgccttgattgtgctaagatagagagg
gaggccttatgacgagaacagggtatgtcaacaatgcctttggaccttgttggactgtgt

 1.06 Intr +  10426  10543  118  0  1   94   82   143 0.999  14.84
tggtcgccatgtgaatttgccttgaaggagaagcaagggttctggtgctgagtcagccag
tccttgcattagagggtgccccatctttgggatatgtggaagctcaggaacctggttctg
aggaggagccaagcctgggtttgttcccaactggtggttctctgccctctctgcccccag
CTGCCTGTGTCAGGGAATCTGCTTGATGTGTACAGTAGTCAAGGCGTGGCCACACCAGCC
ATCACTGTCAGCAACTCCTGCCCAGCTGAGCTGCCCAACATCAAACGGGAGATCTCTG
gtaggtgatagggtcttggccccatggccctacactttaccccaggtgagccctgtgcct
accaggtctagagatgggcctgattctgaggggaatggtttggacatatggaaatggagg
ctgtttgtcccctttccccctatggcttgtggtcttgctttcaccccacttcagttcctc

 1.07 Intr +  10895  10951   57  0  0   93   71    59 0.943   4.05
cagttcctctcgtcttggatttaacaaccagcctatcaccatggcttaaaatagtaaaaa
gaaggcactttttaaaaaaggcatttcccctgcttttggctaccaaaccctaccttagta
tctgcatgtgtttcttgccttcctgtgctcagaggccctgatcactccactcttttccag
AGACCGAGGCAAAGGCCCTTTTGAAGGAACGGCAGAAGAAAGACAATCACAACCTAA
gtaagccagagagcgtgtgcattgcccgggtgctgtgcaggcctgcctcaccccgagtcc
tggccccccatggggaactccttccctgcaacagcctcccaactccctactttctgtctc
ttccatttttggctaattgacaactctttctcccactctttcttcctctcctcccctctc

 1.08 Intr +  11137  11212   76  2  1   88   86    82 0.973   7.07
ccagagagcgtgtgcattgcccgggtgctgtgcaggcctgcctcaccccgagtcctggcc
ccccatggggaactccttccctgcaacagcctcccaactccctactttctgtctcttcca
tttttggctaattgacaactctttctcccactctttcttcctctcctcccctctccaaag
TTGAGCGTCGCAGGCGATTCAACATTAACGACAGGATCAAGGAACTGGGCACTCTCATCC
CTAAGTCCAGTGACCC
gtgagtctgggctgggaccctcaggccagcgggaggtggggcaggcgtcccatgctacta
aaattgtgccttggtgggctcaccaggcagtctcggcccaggcatttctcctctgtctgg
ttctttctcagcctgagcagggttgcagaccctcactatgtcagcacctaaaattttagg

 1.09 Intr +  13133  13280  148  2  1   68   36   338 0.966  27.35
ggcaccattgtaagattccaggcgggaagttttcctctggatactccatacctttgaaag
accccagcctcaagttctaagcatgtggtgggaggctcccacctggtgcaatccccgcct
cagctcctgagaaactcctcatgtggcatttcctgcttgcctcccacttgggccccacag
GGAGATGCGCTGGAACAAGGGCACCATCCTGAAGGCCTCTGTGGATTATATCCGCAAGCT
GCAGAAGGAGCAGCAGCGCTCCAAAGACCTGGAGAGCCGGCAGCGATCCCTGGAGCAGGC
CAACCGCAGCCTGCAGCTCCGAATTCAG
gtttgaaaagaggagatggtggtgggggaagagggggagagcttcctgcaggtggaggca
gagagagagcaggccagggtttcccttcctggcatacttgggggatccctgggcttccca
gatcacacgatgatgatagtgataatgataaataataatcataatattaacaaggataat

 1.10 Term +  14080  14523  444  0  0   93   43   389 0.996  30.52
tacagtttgcgactctgaagcttcagagatgttaagcaccttgcctaaagttttggaact
agtgagtagcagaagctgaattccaacccagggaacctacccttttcaacctttatactc
ctctgcctctgagggactctgaaccctacttatcctgcacccaacccctattttttacag
GAACTAGAACTGCAGGCCCAGATCCATGGCCTGCCAGTACCTCCCACTCCAGGGCTGCTT
TCCTTGGCCACGACTTCGGCTTCTGACAGCCTCAAGCCAGAGCAGCTGGACATTGAGGAG
GAGGGCAGGCCAGGCGCAGCAACGTTCCATGTAGGGGGGGGACCTGCCCAGAATGCTCCC
CATCAGCAGCCCCCTGCACCGCCCTCAGATGCCCTTCTGGACCTGCACTTTCCCAGCGAC
CACCTGGGGGACCTGGGAGACCCCTTCCACCTGGGGCTGGAGGACATTCTGATGGAGGAG
GAGGAGGGGGTGGTGGGAGGACTGTCGGGGGGTGCCCTGTCCCCACTGCGGGCTGCCTCC
GATCCCCTGCTCTCTTCAGTGTCCCCTGCTGTCTCCAAGGCCAGCAGCCGCCGCAGCAGC
TTCAGCATGGAAGAGGAGTCCTGA
tcaggcctcacccctcccctgggactttcccacccaggaaaggaggaccagtcaggatga
ggccccgccttttcccccaccctcccatgagactgccctgcccaggtatcctgggggaag
aggagatgtgatcaggccccacccctgtaatcaggcaaggaggaggagtcagatgaggcc

Predicted peptide sequence(s):


>TFE3_1|GENSCAN_predicted_peptide_1|575_aa
MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLD
PDSFYELKSQPLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQL
MRAQAQEQERRERREQAAAAPFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQ
THLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPT
GSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEMLSYLPGGTTGLQLPSTLPVSG
NLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDNHNLIERRRRF
NINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN
RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVG
GGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
LSPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES