GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:04:01

Sequence SLC9A6_1 : 64065 bp : 40.32% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1236   1578  343  2  1  101  -11   437 0.200  30.54
cagaggggcaaaggaacctggcagagcgagcttgggatgccgcggcccctttaagagcgg
cggcggcggcgcgcgctccgacggctacccccgggccccgcccctttcccgtgagccctc
ggggagtggtccgaccgcgggcggccgccggtgaggtaggggcgggaggcggggggagac
ATGGCTCGGCGCGGCTGGCGGCGGGCACCCCTCCGCCGTGGCGTCGGCAGCAGTCCCCGA
GCCCGCAGGCTCATGCGGCCCCTTTGGTTGCTCCTCGCAGTGGGCGTCTTTGACTGGGCA
GGGGCTTCGGACGGCGGCGGCGGAGAGGCTAGAGCCATGGACGAGGAGATCGTGTCCGAG
AAGCAAGCCGAGGAGAGCCACCGGCAGGACAGCGCCAACCTGCTCATCTTCATCCTGCTG
CTCACCCTCACCATTCTCACAATCTGGCTCTTCAAGCACCGCCGGGCCCGCTTCCTGCAC
GAAACCGGCCTGGCTATGATTTATGGCAAGTTCCTCAACCCTT
gtcagccccttggcgctgcccctttctctgcccgccggctgcttcgcctcctctgctggc
cctgctcggcctacgttcggctccccttctaattccttccattttctgcctcgccttccc
cctaccccgcgtttctctgcctcaccccctttcctcttcagcctcgcgccccattttatc

 1.02 Intr +  10519  10718  200  2  2   60  115   128 0.542  10.85
ttgggctgtttgttgtatgaatttagtaatattttaaaacataactgcatttcatctaaa
aatcagttctgagctacagggaactaccgtaagagattttctcttatccatagttatgcg
tggggtacaaaagaagtggtctctgtcggcaagaagagcttatgttgttcttttttccag
GTCTTTTGGTGGGCCTTGTGCTTCGGTATGGCATTCATGTTCCGAGTGATGTAAATAATG
TGACCCTGAGCTGTGAAGTGCAGTCAAGTCCAACTACCTTACTGGTAAATGTTAGTGGAA
AATTTTATGAGTATATGCTGAAAGGAGAGATTAGTTCACATGAACTCAATAATGTTCAAG
ATAATGAAATGCTTAGAAAG
gtaagttcttaaaggaaatctttgaatcttttttgtgtctaactagcagcaaaatgatcc
aggagaaaataagtaatggatttttaatgatatttaaaataatgagtctttttcaatgga
gtaaaacctcaattaacaaatgtaataatgtaaggaaatggatatgtctgtacaactcat

 1.03 Intr +  13841  13918   78  1  0   71  110    14 0.513   0.73
ctggtcgtttggttgagaagtagaatagaaactatcctatatgaaatatttttaagttag
cacagtaatgttcttgcctttgactagtttaacatatagtattttttctttttgatcatt
tgataatggaatatgaggtcttctagggaattgatctaaaataactctttattttaacag
GTTACTTTTGATCCAGAAGTATTTTTCAACATATTACTTCCTCCTATCATATTTTATGCA
GGTTATAGCCTGAAAAGG
gtaagtccttttgtctttcatatactttgaataatcttaaactcagtgggctttgtaata
tttgacacttcagaaatgggctgttctttccagattaccctcctttctcctctccttatc
ctttttagatgctgaaatttatacctgtacaagaatgctttctcttatttatcctagtga

 1.04 Intr +  14215  14291   77  0  2   70  106   -13 0.531  -3.91
tatcctttttagatgctgaaatttatacctgtacaagaatgctttctcttatttatccta
gtgaataatgcatttaatcctagtgaataatgcatttcatattagcatagcatagaaaac
cttttctttttcaagtaactggtaagtattctaacagtgtaacttttttttttttgtcag
AGACATTTTTTTCGAAATCTTGGGTCTATCCTAGCATACGCTTTTCTTGGAACAGCAATT
TCTTGTTTCGTTATTGG
gtaagtattttaagcttaaaatactttgtggccttcaaattataattttaaaataatata
tttttgatttatgcagtgttatatattcctgactgggtctaaagacttttgcaatattca
cgtaggtaataagttgtttgaattttccttaaggccaaagtattaccatatttcaatgac

 1.05 Intr +  14589  14701  113  0  2   47   91    82 0.485   3.50
tcacgtaggtaataagttgtttgaattttccttaaggccaaagtattaccatatttcaat
gacatgaattaaatttgggattagtcacaaagtactacagtaaacccatcttcttacttt
atcctaatttttttaacagttgatatttttttctaaagtaggactgtgtttattgaacag
GTCAATAATGTATGGCTGTGTAACGCTGATGAAGGTAACGGGACAACTTGCAGGAGATTT
TTACTTTACAGATTGCCTACTGTTTGGTGCCATTGTATCAGCAACTGATCCAG
gtatgttttatatgagtggagtttacatacttgaggtgcattgttttgcagtcaaataca
tgtgggtttttctttctttgaggtgtagaattcatgattagatacttccttagtactata
ctttctaattgtggaggaaaaaacaaaattcatgattccttttggcttcagcacaaattt

 1.06 Intr +  17841  17946  106  1  1   77   99   106 0.570   8.95
aattagaaaagaaaaatatttatataaaattacggggtctttaatatggtaagagaatgt
ttattaggattgaattctaggaggaaatgaatttctaaataactctcagagtcatctact
gaggagaatatgttatatttgtaatgtctaagtattcctctgactctttttacttactag
TGACTGTTCTTGCTATATTCCACGAGCTTCAAGTTGATGTTGAACTCTATGCACTTCTTT
TTGGTGAAAGTGTCCTCAATGATGCTGTTGCCATAGTGCTGTCCTC
gtaagtgtttgttttcttattatattctgaatattaagtgtgagggtactaggaactgaa
agtcacttattgaataaagtacattatgaatggaaacatttggaagaatgaggcattttt
ttccctcttgaagaaatccatattttatagataaattggaaaatacagggaagagaaaaa

 1.07 Intr +  26684  26835  152  2  2   98   39    -5 0.046  -5.51
tgcatagggtttggtgccctaaaactttcactgcaagtgtataattagagatgatatctc
tctgagggtgaattttatagttgtagattaaatagctgtaaaggtagacatattccaaag
agcctctgggtgttctgtgttgctggtcagcctggcagtcttttgctctttgtttaatag
GACAAATAGGAAATGTACAACAGCGACGCCGAATGAACAAAATGTGTTTCCTTGGTTAGG
ATATGTAAGAGTTCATCTCAGCTCTCCCGATTTTAAACTTTGTGCTCTAGAGCCCTGGAC
GGGAAGCCCAAAGGACCTGAGTTGTAGTCCTG
gtactaccacttagtcaagttattcttgtgttcatgcaaaggccattttatcccggactt
caccaccatgcaatatatccatgtcataaaactgcacttgtgcatcctgaatctataaaa
acaaattttatttttatttatttatttgtttttttgagacggagtctcactctttcgccc

 1.08 Intr +  27367  27492  126  2  0   42   70   102 0.340   3.53
ctgatctcgaactcctgacgtcaagtgatccacccacctcggcctcccaaagtgctggga
ttacaggcatgagccaccgtgcccggcctaaaaacatgttttaaaccccccacccaaaac
aaaaagccagaaggcatgtctggatcacctgctacatgtgctgtgctctgtgtatcaaag
CTAAAGAAGACAAACATGACCTCTGCCTCCCTGGTGCTTTCGATATAGTGGCAGACACAA
ACATGCTAGAAGCTTTGACACTTCACCTCTTTGGATCTCAGTGTAGGAAATTGGAGGGTG
GGGACG
gtaggaaagaggagtgggactagatgatgtctaaagagtttccagctctggcctggtgca
gtggctcgtgcctgtaatcctagcactttgggaggccatggcgggcggatcacaaggtcg
ggagatcgagaccatcctggccaacacggtgaaaccccgtctctactaaaaattcaaaaa

 1.09 Intr +  29082  29170   89  1  2   89  110     4 0.587   1.47
atttaggttgttgctttagaacataaaaaaaaattttcagtggaagtggttcctcttaac
aaagtaagtcacaaatgagaatttccagacaaagcctataatctactgtgaagaaagaac
ctcagtataaaaggtgggaaccatccttttatgtgaacttggaatttgttgtctttatag
GTGTAGTTGCAGTATTGTTTTGTGGCATCACACAAGCACATTATACGTATAATAATTTGT
CCACGGAGTCTCAGCATAGAACTAAACAG
gtaagaggaactttatagtttgtgaataggcttttccttctttcagcaaaatagaagtct
tttttactaaaaaaaaaaaatagtctttgatctgttcaagatgctatctactcattttgg
ctcctcttcctttgactctaaaagtaggtgggattggcaaaatgaagaatgacagcattt

 1.10 Intr +  38319  38430  112  2  1   47  119    22 0.003   0.23
tatagaaaatttccatcattgcagaaagttctgttggacagtgttatgttagacaatgga
accaagagactgtgtgttagaaactgagttccctaaaatagtctttcaccatcttgagtg
tatagtctaaataatattaatagtaaaatgaaatgatccttaacctattaataattttag
GTTGCTATTTTCTTGGGAAGAGCTGCCAATATTTACCCCTTGTCCCTCTTACTTAATTTG
GGTAGAAGAAGTAAGATTGGATCAAATTTTCAACACATGATGATGTTTGCTG
gtaagttgtaactttcttctcttgcccacttcaagcaaccattcacaatgcgtgtgccag
cttgatgtaacactgagatgttatgctggtcatataatactcctttatttttatattatt
tatttatttagagacactgtttcactctgtcgcccaggctgtagtgcagtggcacgatct

 1.11 Intr +  40063  40216  154  2  1   82  111   115 0.868  11.41
gtgctgggattacaggtgtgagccaccatgcacagcctggacatatttaagtatgttaat
atttactgcatatttgttcacatgcttctaagtttttagaacgtgctttcttgctctgaa
tttatgaagcttgcattggtaatgagttattgaagaaataccttttctgttcccctgtag
GCCTTCGTGGTGCAATGGCATTTGCCTTGGCCATTCGAGATACTGCCACTTATGCACGGC
AAATGATGTTCAGCACCACGCTTCTGATTGTGTTTTTTACCGTGTGGGTATTTGGTGGTG
GCACCACTGCAATGCTGTCATGCTTGCATATCAG
gtaagtactaactagagacctcattttaagattaaattttaatttggtttatttttctgc
ctgttttcaatttttaatctttggagaatctgtaatgttttattttttccttttaaaaag
tatgtaatatatagtacagaaaaaggaaaatatatatgcaaaagaaaaattcattgttaa

 1.12 Intr +  55809  55914  106  0  1   55  100    82 0.305   5.40
tgataaaatacccctttgctgtttcactgccatcatgtgaggaggaaatgagaccataga
tgtgaaagccctttgctgtcctccgaagtggttactatactatgatggtgattattatca
aacgagttgctcttttaaatttgtaaagaaaggaccacagctcttccttaaccaccgcag
CTATCTGAAGCCTCTGCTGACCCACAGCGGGCCTCCGCTGACAACAACACTCCCTGCCTG
CTGTGGACCCATCGCCAGGTGCCTCACCAGCCCCCAGGCTTACGAA
gtaagttggttttatccaaaactaaattcttcagtaagttaaatttatctgctctgtgga
tgagtcactggttttattttattttggtttgtttttttgcctttgaggtataaattccat
gaaagggaatttaagcatattttgctcaaccagaaaatacactgaaacctataaatataa

 1.13 Term +  60185  60457  273  1  0   67   43   322 0.982  20.09
gaggaactaaggatgccaagtcacgctgtattttaagccaaggtatggactttagacttt
atcctgagggcagtgggctaccacttaagggttttaatgggggatcctcgaaaatactcc
tattggaaatgtctcttgaacttctcaaaaattcttaaatcttactttatttgcatttag
AACCAGGAACAGTTGAAAGATGATGATTCTGATCTTATTCTCAATGATGGTGACATCAGT
TTGACATATGGAGATTCTACTGTGAACACTGAACCGGCCACATCCAGCGCCCCAAGGAGA
TTTATGGGAAACAGTTCTGAAGATGCCTTGGATCGGGAGCTTGCATTTGGGGACCATGAA
CTGGTCATTCGAGGAACACGCCTGGTTCTTCCAATGGATGATTCTGAACCCCCGCTAAAT
TTGTTAGATAATACGAGACATGGTCCAGCCTAA
gcttactaatactcacttagtgatttgtaaaatttgcacatgtgattgtgaagaaatttg
tactacctaaaagtcccagtgcatgtctctgaatgtgtaagctatataaatgctatttat
atggcatagaaagaatataaatatcctgtacacggcagattgtgaacaaactatattcct

Predicted peptide sequence(s):


>SLC9A6_1|GENSCAN_predicted_peptide_1|642_aa
MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASDGGGGEARAMDEEIVSE
KQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGKFLNPCLLVGL
VLRYGIHVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYMLKGEISSHELNNVQDNEMLR
KVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISCFVIGSIMYGCV
TLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYALLFGESVLNDAV
AIVLSSTNRKCTTATPNEQNVFPWLGYVRVHLSSPDFKLCALEPWTGSPKDLSCSPAKED
KHDLCLPGAFDIVADTNMLEALTLHLFGSQCRKLEGGDGVVAVLFCGITQAHYTYNNLST
ESQHRTKQVAIFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDT
ATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHISYLKPLLTHSGPPLTTTLPACCGP
IARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSED
ALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA