GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:15:52

Sequence SLC6A8_1 : 11048 bp : 64.52% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1839   2100  262  2  1  103  105   555 0.957  56.12
ccgcccgcgccccgcaccccgccgcccgcccgccgccccgtcccccggcccggccgcccc
ccggcccccggccggcccgcgccctcggggccctccccggtgccgccggtgccccccgcc
tgaccgccgccccccgtgaggcgccgcgaccccggcccggccgtgcggcccgccgaggcc
ATGGCGAAGAAGAGCGCCGAGAACGGCATCTATAGCGTGTCCGGCGACGAGAAGAAGGGC
CCCCTCATCGCGCCCGGGCCCGACGGGGCCCCGGCCAAGGGCGACGGCCCCGTGGGCCTG
GGGACACCCGGCGGCCGCCTGGCCGTGCCGCCGCGCGAGACCTGGACGCGCCAGATGGAC
TTCATCATGTCGTGCGTGGGCTTCGCCGTGGGCTTGGGCAACGTGTGGCGCTTCCCCTAC
CTGTGCTACAAGAACGGCGGAG
gtgagttcccccgcccgccgcggcctcctcccccagcaggccgccggcccccgcccgacc
cccggagccgccgcggaggggtgaagtccgggcaacgggtggcccccgggcacgcggggg
tcggggccgcccctcgtccgccgctgccgctcggtggccgggccgggcgcctccaccccc

 1.02 Intr +   3639   3770  132  1  0  107  105   165 0.999  21.90
cttcaacacactcaacccaccccctcaagactccacctggggcctgagtcagtggccacc
cctacactgactcacccagtcggaagttgtgatggggcctttggagtctgggctggcccg
ctgggcctgggcagcctggctgggggccaccctgagtccacgctgtgcctccacccccag
GTGTGTTCCTTATTCCCTACGTCCTGATCGCCCTGGTTGGAGGAATCCCCATTTTCTTCT
TAGAGATCTCGCTGGGCCAGTTCATGAAGGCCGGCAGCATCAATGTCTGGAACATCTGTC
CCCTGTTCAAAG
gtgagcagcccttggccagcctcagggactgcccccttctcccagctggctcccacttga
gaaatcttttcctgtcgtgagcaccaggcctggggccacgtgatggcgtcccagtctcga
ggggggagcctggaggagatgttcaggccgcacagcgaacttggggaagcggggactaga

 1.03 Intr +   4568   4817  250  0  1   -3   64   471 0.991  33.34
gggagtcagcgcagtgttggggctcacacaagggggagcccaggggagtcaggagcacca
caaacaaggctccaggaggacagatggtgggagcacggccagcctgggtggggacataaa
ggggtggcagggggaggtggccagggaagaatctacatggcaaggacttcccggccccag
GCCTGGGCTACGCCTCCATGGTGATCGTCTTCTACTGCAACACCTACTACATCATGGTGC
TGGCCTGGGGCTTCTATTACCTGGTCAAGTCCTTTACCACCACGCTGCCCTGGGCCACAT
GTGGCCACACCTGGAACACTCCCGACTGCGTGGAGATCTTCCGCCATGAAGACTGTGCCA
ATGCCAGCCTGGCCAACCTCACCTGTGACCAGCTTGCTGACCGCCGGTCCCCTGTCATCG
AGTTCTGGGA
gtgagtccggcacctctgggccaagcccatcccatcccccaggtctccctcatgttgccc
ggctccaggggagtggccctgagggggcaccagggtgttgcctggcagtccatcctggac
cctgcctgcccttgcctgtcctcggagagtcctggggccagcctcgctcctgggttcggc

 1.04 Intr +   5239   5371  133  1  1  108   76    52 0.993   7.83
gatgggagtggcctcccaatggccaggggatcgtgggctccaggcccagcccaattggac
aagagggacccgctgaaccctgggctgtgggagagaagggagccacaactcctgggggtg
gaccctgtggctccatcctctgctggcacaggcctcatgggacctccctccctcccctag
GAACAAAGTCTTGAGGCTGTCTGGGGGACTGGAGGTGCCAGGGGCCCTCAACTGGGAGGT
GACCCTTTGTCTGCTGGCCTGCTGGGTGCTGGTCTACTTCTGTGTCTGGAAGGGGGTCAA
ATCCACGGGAAAG
gtaccactagaggcatgcagcggggagggtggctcagccctgggagccggatgtctgtgc
caggcacacctgtggcaacgggaggtgaccagacagagtctagccctaaggaagggggag
gtactgaaagccaagcaatgctccccaccctgcaaatccagggcccagcagcctttgctc

 1.05 Intr +   6305   6439  135  1  0   36   94   150 0.973  12.35
gcacttggccagggctgccggggcgcagccttgcccctagcttcctctggcgggagccat
ggctcggaggacaatggggacctctgaacatacctgcccgcaagggggaccggaggcgct
gggagtgggggtgtgagggaggtggtgccacagcctccgctgagcagcctggccccccag
ATCGTGTACTTCACTGCTACATTCCCCTACGTGGTCCTGGTCGTGCTGCTGGTGCGTGGA
GTGCTGCTGCCTGGCGCCCTGGATGGCATCATTTACTATCTCAAGCCTGACTGGTCAAAG
CTGGGGTCCCCTCAG
gtgaggtggaggtggagaggctgcagcagggcgctgcgggggagccctgcaggcccctca
tgcctgcgctctccggcccttctctaggtgtggatagatgcggggacccagattttcttt
tcttacgccattggcctgggggccctcacagccctgggcagctacaaccgcttcaacaac

 1.06 Intr +   6527   6630  104  1  2  123   82   152 0.999  18.24
gtgctgctggtgcgtggagtgctgctgcctggcgccctggatggcatcatttactatctc
aagcctgactggtcaaagctggggtcccctcaggtgaggtggaggtggagaggctgcagc
agggcgctgcgggggagccctgcaggcccctcatgcctgcgctctccggcccttctctag
GTGTGGATAGATGCGGGGACCCAGATTTTCTTTTCTTACGCCATTGGCCTGGGGGCCCTC
ACAGCCCTGGGCAGCTACAACCGCTTCAACAACAACTGCTACAA
gtaagcaccgccgccctgccacccgtgccctgtcctgccctgccccgccctgcccagcag
cctaacccatccactctggcccctccacccctcagggacgccatcatcctggctctcatc
aacagtgggaccagcttctttgctggcttcgtggtcttctccatcctgggcttcatggct

 1.07 Intr +   6726   6850  125  0  2   95   91   219 0.999  24.30
cccagattttcttttcttacgccattggcctgggggccctcacagccctgggcagctaca
accgcttcaacaacaactgctacaagtaagcaccgccgccctgccacccgtgccctgtcc
tgccctgccccgccctgcccagcagcctaacccatccactctggcccctccacccctcag
GGACGCCATCATCCTGGCTCTCATCAACAGTGGGACCAGCTTCTTTGCTGGCTTCGTGGT
CTTCTCCATCCTGGGCTTCATGGCTGCAGAGCAGGGCGTGCACATCTCCAAGGTGGCAGA
GTCAG
gtagggccctacccccagccccgcctccagagcagcgagtgctacccagatgcatgatgt
acaggaacatgcaatagaaatgctgaaaagtgacgaggattcaaacggaacttgtcagat
tgtgggcctgtgggggcaggtcctgggatttgtcaatgttgacagagaaaggacctccca

 1.08 Intr +   7169   7281  113  0  2   53   41   147 0.998   7.77
ggtcctgggatttgtcaatgttgacagagaaaggacctcccagcccctgccgcacgaccc
agggttgacagcgcctctgaggcaggcgtgggcatgggcgcgagtgttgcaggcagggct
cagggtgcgcacagggcaggacatcggctacaaggtctagagcctgcacctttcccacag
GGCCGGGCCTGGCCTTCATCGCCTACCCGCGGGCTGTCACGCTGATGCCAGTGGCCCCAC
TCTGGGCTGCCCTGTTCTTCTTCATGCTGTTGCTGCTTGGTCTCGACAGCCAG
gtttgcatggggctctgggacagggagccaggaggggggcggagggagggctgcaggcaa
ggaaaggggtggagggcggtgcggggctcggcctgagctgccctggccacagtttgtagg
tgtggagggcttcatcaccggcctcctcgacctcctcccggcctcctactacttccgttt

 1.09 Intr +   7394   7531  138  1  0   42   76   134 0.945   9.44
tgccagtggccccactctgggctgccctgttcttcttcatgctgttgctgcttggtctcg
acagccaggtttgcatggggctctgggacagggagccaggaggggggcggagggagggct
gcaggcaaggaaaggggtggagggcggtgcggggctcggcctgagctgccctggccacag
TTTGTAGGTGTGGAGGGCTTCATCACCGGCCTCCTCGACCTCCTCCCGGCCTCCTACTAC
TTCCGTTTCCAAAGGGAGATCTCTGTGGCCCTCTGTTGTGCCCTCTGCTTTGTCATCGAT
CTCTCCATGGTGACTGAT
gtgagtggggtggggggtctgcctgtgacctctggtggccgtctgccatcctccctgact
gggctctgtcccccagggcgggatgtacgtcttccagctgtttgactactactcggccag
cggcaccaccctgctctggcaggccttttgggagtgcgtggtggtggcctgggtgtacgg

 1.10 Intr +   7608   7710  103  2  1  103   90   153 0.999  17.91
tcgacctcctcccggcctcctactacttccgtttccaaagggagatctctgtggccctct
gttgtgccctctgctttgtcatcgatctctccatggtgactgatgtgagtggggtggggg
gtctgcctgtgacctctggtggccgtctgccatcctccctgactgggctctgtcccccag
GGCGGGATGTACGTCTTCCAGCTGTTTGACTACTACTCGGCCAGCGGCACCACCCTGCTC
TGGCAGGCCTTTTGGGAGTGCGTGGTGGTGGCCTGGGTGTACG
gtaggtcatggctgagggctgggctgggggatggtggcggggaaggcaggtctccagctt
ggccctcccgcctcacctcgccgcaggagctgaccgcttcatggacgacattgcctgtat
gatcgggtaccgaccttgcccctggatgaaatggtgctggtccttcttcaccccgctggt

 1.11 Intr +   7797   7897  101  1  2   83   91   134 0.997  14.19
tacgtcttccagctgtttgactactactcggccagcggcaccaccctgctctggcaggcc
ttttgggagtgcgtggtggtggcctgggtgtacggtaggtcatggctgagggctgggctg
ggggatggtggcggggaaggcaggtctccagcttggccctcccgcctcacctcgccgcag
GAGCTGACCGCTTCATGGACGACATTGCCTGTATGATCGGGTACCGACCTTGCCCCTGGA
TGAAATGGTGCTGGTCCTTCTTCACCCCGCTGGTCTGCATG
gtaagggctgggggaggtggggcagggcggggggcgaggcagggcggggtaggggcccca
ttaaccgcagcattctggtccgtagggcatcttcatcttcaacgttgtgtactacgagcc
gctggtctacaacaacacctacgtgtacccgtggtggggtgaggccatgggctgggcctt

 1.12 Intr +   7983   8153  171  2  0   69   94   279 0.999  27.94
accgcttcatggacgacattgcctgtatgatcgggtaccgaccttgcccctggatgaaat
ggtgctggtccttcttcaccccgctggtctgcatggtaagggctgggggaggtggggcag
ggcggggggcgaggcagggcggggtaggggccccattaaccgcagcattctggtccgtag
GGCATCTTCATCTTCAACGTTGTGTACTACGAGCCGCTGGTCTACAACAACACCTACGTG
TACCCGTGGTGGGGTGAGGCCATGGGCTGGGCCTTCGCCCTGTCCTCCATGCTGTGCGTG
CCGCTGCACCTCCTGGGCTGCCTCCTCAGGGCCAAGGGCACCATGGCTGAG
gtaaggctcccgcccggcccgccctcccctcccctgctgtgaacattcaacccagcctgc
ttcctagccagggagtggccccgactagggtggcaggcagtgggaaccggagagaggcag
aggaagtcaccgtggggacgagcaggtgaccctgggggcttcagcatgtcctcctctcct

 1.13 Term +   8338   8478  141  0  0  115   48   192 0.968  16.77
ggctcccgcccggcccgccctcccctcccctgctgtgaacattcaacccagcctgcttcc
tagccagggagtggccccgactagggtggcaggcagtgggaaccggagagaggcagagga
agtcaccgtggggacgagcaggtgaccctgggggcttcagcatgtcctcctctcctgcag
CGCTGGCAGCACCTGACCCAGCCCATCTGGGGCCTCCACCACTTGGAGTACCGAGCTCAG
GACGCAGATGTCAGGGGCCTGACCACCCTGACCCCAGTGTCCGAGAGCAGCAAGGTCGTC
GTGGTGGAGAGTGTCATGTGA
caactcagctcacatcaccagctcacctctggtagccatagcagcccctgcttcagcccc
accgcacccctccagggggcctgcctttccctgacacttttggggtctgcctgggggagg
aggggagaaagcaccatgagtgctcactaaaacaactttttccatttttaataaaacgcc

Predicted peptide sequence(s):


>SLC6A8_1|GENSCAN_predicted_peptide_1|635_aa
MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMD
FIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGS
INVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPD
CVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLL
ACWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKL
GSPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVF
SILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFV
GVEGFITGLLDLLPASYYFRFQREISVALCCALCFVIDLSMVTDGGMYVFQLFDYYSASG
TTLLWQAFWECVVVAWVYGADRFMDDIACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV
YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWG
LHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM