GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:29:04

Sequence SLC25A5_1 : 5270 bp : 50.68% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1207   1381  175  1  1  103   98   301 0.861  32.54
gcggagagcagtcccggcccgccctccacgactcctcctcctgcgagctgggccactcag
cggctctgccgcccagcgcgccggggcccagaccccgccccggccccgcctccgacgcct
gccgctccagctccggctccccctatataaatcggccatttgcttcgctccgccccgcag
CGCCGGAGTCAAAGCCGGTTCCCGGCCCAGTCCCGTCCTGCAGCAGTCTGCCTCCTCTTT
CAACATGACAGATGCCGCTGTGTCCTTCGCCAAGGACTTCCTGGCAGGTGGAGTGGCCGC
AGCCATCTCCAAGACGGCGGTAGCGCCCATCGAGCGGGTCAAGCTGCTGCTGCAG
gtacgtcctgggatccaggagcccaaccaggaagtggggggaagggtcgcacagaaggcg
ggcgcccgaggggtggcggggagcgaactctaaagacatggccagggaagcggcttagga
gaggccagagcggggcgcagaggcagaacagaagtcaaactggtgggaggcgcctttagt

 1.02 Intr +   2416   2902  487  0  1   85  110   443 0.974  38.79
cacctcttcccctgtgacagcctcagagggttgggagggtccagccagtatgatatacga
agactagatttgagagaggggagcctaccttaaagggcattgatcgagatggcataagct
cttctctttcccttccccatggttataactgtccctgttggcttccttcctgtctgttag
GTGCAGCATGCCAGCAAGCAGATCACTGCAGATAAGCAATACAAAGGCATTATAGACTGC
GTGGTCCGTATTCCCAAGGAGCAGGGAGTTCTGTCCTTCTGGCGCGGTAACCTGGCCAAT
GTCATCAGATACTTCCCCACCCAGGCTCTTAACTTCGCCTTCAAAGATAAATACAAGCAG
ATCTTCCTGGGTGGTGTGGACAAGAGAACCCAGTTTTGGCTCTACTTTGCAGGGAATCTG
GCATCGGGTGGTGCCGCAGGGGCCACATCCCTGTGTTTTGTGTACCCTCTTGATTTTGCC
CGTACCCGTCTAGCAGCTGATGTGGGTAAAGCTGGAGCTGAAAGGGAATTCCGAGGCCTC
GGTGACTGCCTGGTTAAGATCTACAAATCTGATGGGATTAAGGGCCTGTACCAAGGCTTT
AACGTGTCTGTGCAGGGTATTATCATCTACCGAGCCGCCTACTTCGGTATCTATGACACT
GCAAAGG
gtaagtttgctgtgggctttaacgttgtgttcttaggagacagtttaaaagagcattgta
ccaacctaacagtccaagagctaaagagttgtttttttaattgctaaaggaagccaagat
catccaatgcaacccttgtgtacagatgacgtgtttaggggatgtggggaaaggaagtca

 1.03 Intr +   3128   3268  141  0  0   80  100   144 0.999  15.12
taaaagagcattgtaccaacctaacagtccaagagctaaagagttgtttttttaattgct
aaaggaagccaagatcatccaatgcaacccttgtgtacagatgacgtgtttaggggatgt
ggggaaaggaagtcagtaaaactctgctttttggtaaaagcatctctttcctattcccag
GAATGCTTCCGGATCCCAAGAACACTCACATCGTCATCAGCTGGATGATCGCACAGACTG
TCACTGCTGTTGCCGGGTTGACTTCCTATCCATTTGACACTGTTCGCCGCCGCATGATGA
TGCAGTCAGGGCGCAAAGGAA
gtaagttccacttgagcagaagataaagttgtagtcgtggggcaatctgctgccacaaac
tggtgatacatacctttaaaatggctgtctgtccaagtcaagggatggggttgatagcat
ctgtgtctgttccacaactgcctttgagctggcccttcagatgcctatgaatgagggtgc

 1.04 Term +   3656   3813  158  0  2  130   38   124 0.998   9.70
tgggtagtctgtattcctgtggtcatagcattaatatttcagtgttgcccatgctaatgt
gtgaatgttggatttaaagctgacgttcttagaggtggggctctgctttatttagcctag
tgaatcttaggatttttcatcggccttcagtcactaactccatgtctttattctttgcag
CTGACATCATGTACACAGGCACGCTTGACTGCTGGCGGAAGATTGCTCGTGATGAAGGAG
GCAAAGCTTTTTTCAAGGGTGCATGGTCCAATGTTCTCAGAGGCATGGGTGGTGCTTTTG
TGCTTGTCTTGTATGATGAAATCAAGAAGTACACATAA
gttatttcctaggatttttccccctgtgaacaggcatgttgtattatataacatatcttg
agcattcttgacagactcctggctgtcagtttctcagtggcaactatttactggttgaaa
atgggaagcaataatattcatctgaccagttttctcttaaagccatttccatgatgatga

Predicted peptide sequence(s):


>SLC25A5_1|GENSCAN_predicted_peptide_1|320_aa
XAGVKAGSRPSPVLQQSASSFNMTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQV
QHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQI
FLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLG
DCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQ
TVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNV
LRGMGGAFVLVLYDEIKKYT