GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:48:05

Sequence RPS6KA3_1 : 113670 bp : 37.75% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    995   1269  275  0  2   42  105   394 0.975  32.83
tgtgagcggaagtgggggagcgcgcggcggtcgctgttctgctgggagcgggcgcgggaa
ccggcggggggggcggagccgtagtcccggcggcggaaggaggagaggaagaaaggggcg
agacccggtgcccagcggaggcgcgaggctctcgctcagcgcgcgggcgtctctggccag
GCGCGCGGCTTTCGGGCGGTCGGCGTCGGCGTCGAGCCCTCTCTGGGGCCGCCGCCGCTG
CTGCTGCTGCTGCCGCTGCCGCTGCCGCTGCCGCCGCCGCCGCCGCCGCCGCCGCTGCCG
TGGGGCTCGGGCGGCGACGGAGCGGGGCCGGCCGTGGGGCGGGCGGGGAGGGAGGAGGCG
GTGAAGGCGGCGGGCCGGGGGGGAAGATGCCGCTGGCGCAGCTGGCGGACCCGTGGCAGA
AGATGGCTGTGGAGAGCCCGTCCGACAGCGCTGAG
gtgagtgcagcagggcggccggggccggcgcatctcctcctcgcgcccccgccggctcgc
ttcgctccccggagctggccactcggcccgttctgatcccgctcgcgtctttcccccggg
ctcagggttttggtttgggttgttggggtgggtctattggccggtctgtctgttccttcc

 1.02 Intr +   2282   2334   53  1  2  148   61   -18 0.564  -1.71
actacaccgagctttcctgaaccgcccctatcccagaacaactcggggtctgcgaaaata
atccagacaagacccgttccaaggtatcaccgctcctctccggagtggaaaatcaattcc
tgatggtggcgcgtctgtgattcttccttcttgactttttgctgccttctctccccgcag
CGGACTTTAGGGGATTACAGGATGATAGGCTGCGTGTGTGTAATAGTTACTGA
gtgagtgaccccatttctggaaagcatgactgaaacgcgggggtggaacggggcaggctc
tgatgagtggtgtgcttggcggcagccgctgccctgccggcctccgcagtgtgagaagta
gatagggttactggttacgtcagtaaaaccgaggctcagtttaatcttgagatgcgggac

 1.03 Intr +  14267  14521  255  2  0  102  108   161 0.899  15.14
gatctttaggaggaaattatgacctataatgttacagcagttttctgtagtacattttca
accataatgtggaaaattagaaaataaatgttattttcaacataaaaattaatcacttgg
aggatacatctggttctgccaagatagaggacccctattcctccttgatctcccttacag
CGAAAACACTGTAGACATAACAAACAAGCACAGGAACACTCTAAAGGTGGAAAAAGAAGG
CAAACAGCCTGCAGACCTCGAGACTCAAGAAAACCCAGGGAATTCACTATTTGTGTTCTT
CCTGTCACCTCCCATATATCCTAGACAGGGTGCTATGAAAGCCTCCAAACTAGAACTGCC
AACAGTCACAGACAAAAAGAGCTCTGAGAAAAAGCCTGTTTCCTTTAGACAAACAACTGG
GGGAAAGGTAGCCAA
gtaagtctaaacctttttgacaatactcaccctaccctggccaaataccatcagaaaaac
cccaccccaccccaccccaaagaagcaaataacagtgctctcactccccaacccagtggt
gtgggctggggagatcagagacctaagcacccatttctttgcccagcaaaagcagacagc

 1.04 Intr +  27228  27264   37  0  1   72   87    44 0.360   0.05
ttttctttgaggccctgattttaaccattgcatagtattcctacatatgaatagatgtat
tatgatttatttaaccagtcccttgttggtcatttagattgttttctatttttcagtata
atgagtatgatgaatatcactgtacataagtctttatgcacatctctgatatttccttag
GATAAATGAGGAGCTGATTCTTAATCCTGTCACATTG
gtaaggattatatacattccttattaagaatataaagtgcttgtttcttattgtttcatt
gtgattgcatagaagattctttggattctgaacaatttggtggtatcttaaccaaagttt
gagagaggtttctaatgcctcatgctcagcaccttcatgatggaattcctattgtgtaag

 1.05 Intr +  33019  33075   57  0  0  102   93    65 0.763   6.56
ttttgaagcacatcctgttgcaaatttagcaactgcatactcatatggtggttctacttc
attagagccctttaggggtgaaaatcttcctcaattttttttttttttgtctgccttcat
ttaactttaactgatgtgaggtctgttttggtaacttcctgcttgctgtgcttttcacag
AATGGACAGCAAATTATGGATGAACCTATGGGAGAGGAGGAGATTAACCCACAAACT
gtaagtaaaatattttatcacaaagggtatagataaatgaaatactgtaaagttattatt
atttttcagctgagcagagtaatcattttacagtgttagaaacttgtcgatcctttcaca
ttaactttaccagactacattattgagtatgccagggacctttctaaaaactgtttgata

 1.06 Intr +  58429  58545  117  0  0   99  115    72 0.999  10.74
tcacttgatgggttggtaaaaggtggtttttgtatgttaatttgggatttctaatatgtt
tagaaattagattgatttctaattaatttctagtaagattaaattaatattgtttgattt
ttagcgggagaaaatagctctggctaaccctgtttgctcctcttacgtttatctcaacag
GAAGAAGTCAGTATCAAAGAAATTGCAATCACACATCATGTAAAGGAAGGACATGAAAAG
GCAGATCCTTCCCAGTTTGAACTTTTAAAAGTATTAGGGCAGGGATCATTTGGAAAG
gtaagtcatgagtgtgtgcttttttaagagttgtcttttcaattcatatgtatttcatat
acatgaggaaacaaatattttatgaaatgctaccagtcttcctaccagcaatgttttctg
tttttttacatttctcactatcagtaagtgggaaagtgaataaagttgttcaaaagtacg

 1.07 Intr +  63730  63811   82  0  1   71  115    64 0.669   5.69
ccccaagttataacaaatgtttataactagtatttataattgatacattttaggggaaat
aatctacagtatatctgaatctatattataataataaactgtattatagcagggtcttat
tttaacaaggatatagtttatactactttgtaatatttattttctcttacttaaatgcag
GTTTTCTTAGTTAAAAAAATCTCAGGCTCTGATGCTAGGCAGCTTTATGCCATGAAGGTA
TTGAAGAAGGCCACACTGAAAG
gtaagtgttgctgctatttgtaatgttcatgtagtctaaacaaactgaaaggtctcaata
gagctcatgggactccttggcatgttatttacattctgaataggttcctgttaccagctt
taaatttaggctgacttttagtgaatttttcctgctaggctaggaatcatataactagtg

 1.08 Intr +  79863  80005  143  1  2   43   91   173 0.805  12.25
agtgagccaagatggcgtcactgtactccagcctgggtgacagagcgagactctgtctca
aaaaacaaacaaacaaaaaaaacttgtattagaaattttaaatgattaatgtcagaactc
aaagtttaaaatttacatgtgcaaatttatgtaggatatttatgatatttgttttggcag
ATTTCGGCCTAAGTAAAGAGTCTATTGACCATGAAAAGAAGGCATATTCTTTTTGTGGAA
CTGTGGAGTATATGGCTCCAGAAGTAGTTAATCGTCGAGGTCATACTCAGAGTGCTGACT
GGTGGTCTTTTGGTGTGTTAATG
gtaaggtttgaatttgggattttttagaggggaaggagattgttaagtgaggatcagcag
tgaatgttaaagaaactggtgtttttattttctttattttatgccatatgtaataaataa
ccaagaaacattattgcatgcagtatagaaggactatgaaatctgttagctgcgtctatc

 1.09 Intr +  91481  91583  103  1  1  124  116    74 0.999  12.63
gaaataaaattatcagtgaatccatttttgataggtgcaggaccagatggagttgaagaa
attaaaagacattcatttttctcaacgatagactggaatgtaagtatagaatgaaaactt
gcttgaaatatttctttataattaaaatatgtctaagtctcttttttttttcccctccag
AAACTGTATAGAAGAGAAATTCATCCGCCATTTAAACCTGCAACGGGCAGGCCTGAAGAT
ACATTCTATTTTGATCCTGAGTTTACTGCAAAAACTCCCAAAG
gtaaggagaaaatgtgaaaatccaaatataagacaacaaatatgtttttttcttgtttca
tcagaaaatcttttccagactctgggcgcggtggctcacacttgtaatcccagcactttg
ggaggctgaggcgagcagatcgcttgaggccaggagttggagaccagcttggccaacata

 1.10 Intr +  92545  92669  125  2  2   94  109   119 0.999  13.98
caatacacaatcagaacagatctgatacagtgcctcacaggtatcctggaaagcaagagg
tatatactgtgtacctgagaaatagaattccagaataagtgaaaaaggtcatagtgtcaa
cagtttttcccttaatttcctttcaaatgaatcttctttgtcacttcttactcttttcag
ATTCACCTGGCATTCCACCTAGTGCTAATGCACATCAGCTTTTTCGGGGGTTTAGTTTTG
TTGCTATTACCTCAGATGATGAAAGCCAAGCTATGCAGACAGTTGGTGTACATTCAATTG
TTCAG
gtgagtggatgtctaaataattttagatttggaatgttgtaagatatagttcattctgtg
aatagatctttttctactgacttcaagtgagcaatttaaaatacattttagactgggcat
agtggctcacacccgtaatcccagcactttgggaggccaaggcagttggatcacttgagg

 1.11 Intr +  94962  95087  126  2  0   51   94    81 0.680   4.96
tcattgtaaacactttcaaaatcacttgtttgtagaataataagtactataaagatgtat
ttttattcttattcatttatatgtagggcatcaacaatgcatgctgagtaacatacttcc
ctattataaaatgcactaaaggcattatgggactcttcaccaatttataattttttgtag
CAGTTACACAGGAACAGTATTCAGTTTACTGATGGATATGAAGTAAAAGAAGATATTGGA
GTTGGCTCCTACTCTGTTTGCAAGAGATGTATACATAAAGCTACAAACATGGAGTTTGCA
GTGAAG
gtaaattttttttatttaaaatgcaattcatacagttcttgttcatgcatgtcagtacca
gttaaaaattacactccccttgttgttaaaagtgccttttgttataaaaaagttaaatat
ctggctagtgatcttcagagatcttaatctagaaccctgtgagctaaaggtaaggtggtt

 1.12 Intr +  98342  98431   90  1  0   58   95   106 0.995   7.57
ctatatcaagactggctttctgattaaacaatctggccaggtagttgaataaaactgact
gataaatggcttatttatacactatttacatgaggtaatacccaaggtctgtagctataa
acaattaatgtttataactgtatagttgatgaggttttgtgataaacatttgccttttag
ATTATTGATAAAAGCAAGAGAGACCCAACAGAAGAAATTGAAATTCTTCTTCGTTATGGA
CAGCATCCAAACATTATCACTCTAAAGGAT
gtaagtagattctttaatatggatcatttgaatcagttgtctaactcacattgaaagtag
tgtattttcaaaaatcatgtggtagacaaagaactcatcataggctgggcacagtggccc
acgcctgtaatcccagcagtttgggaggccaaggcaggaggatcacttgaggccaggagt

 1.13 Intr + 100086 100244  159  2  0   57   98   159 0.999  13.06
tgcagtgagccaagattgtgccagtgcactcctgggcgacagagtctgtctcaaaataaa
taaataaataaaatttgtcttgaatatgaagtgagtttaatttttcctttatattttaaa
cttcgttttgggcacatatagtttcaaataatatttacattttgatgttgaaatttatag
GTATATGATGATGGAAAGTATGTGTATGTAGTAACAGAACTTATGAAAGGAGGTGAATTG
CTGGATAAAATTCTTAGACAAAAATTTTTCTCTGAACGAGAGGCCAGTGCTGTCCTGTTC
ACTATAACTAAAACCGTTGAATATCTTCACGCACAAGGG
gtaagtctttttaccactctatatgtacatacacacacttttttcctttatgtttgagct
agaattagatagaaattactttatgcctgaaatggaaaataactgctattagctgaatta
tcctactgaccttcctctatataaacttttattattgagattgaagtgtacctttgatat

 1.14 Intr + 102773 102934  162  1  0   61   76   160 0.923  11.35
tgcccccggtctatgttagagagttatgctttacattatcagtattttataatgttaggc
taatttaaaggtcagcactcatcatcttgttaagtgcattgcttgacagtttgtgaataa
agaactttcagtaatggaaatatattgttaacataactctttaatttgtatttcaattag
GTGGTTCATAGAGACTTGAAACCTAGCAACATTCTTTATGTGGATGAATCTGGTAATCCG
GAATCTATTCGAATTTGTGATTTTGGCTTTGCAAAACAGCTGAGAGCGGAAAATGGTCTT
CTCATGACTCCTTGTTACACTGCAAATTTTGTTGCACCAGAG
gtaattgtgagagagtttgcttgcagtattagtatgttttaaaactcattcactatgttt
aataccgaattattaataataatttaattgaagacttactgaagaaataattaggataaa
atgccagcctttcatttccctgtttaatgtttcagtgacatctgattgcctacagaagaa

 1.15 Intr + 104793 104869   77  2  2   65  100    35 0.855  -0.21
tatgaattattagtagtagaatgttctagaatcggattaacgtattgccttatttggtaa
ccatgttctgttgaaattttccttataggtgttgatttggaatatataattcaactcata
gccttacaaatatatatacaaaatggtggtatagtaatactaattttgcactttttctag
GTTTTAAAAAGACAAGGCTATGATGCTGCTTGTGATATATGGAGTCTTGGTGTCCTACTC
TATACAATGCTTACCGG
gtgagtgtataccatatgttctaagcacctaagcatttgttcatcaatgttttgcttaag
ttatctaggtttttgttttgtttggggttttttgtttgtttgtttgctttttctttagag
acagggtctcactctgttgcccaggctggagtacagtgacacagccatagttcactatag

 1.16 Intr + 106072 106189  118  1  1   24  115    75 0.815   3.35
tataattaatattttataacctatactttacctggtgccttatggagcttcattttgttg
atttttttcactttggtagattttaataaaatattacattaactgaattagagtactttt
gagattaccaaccaagtaataaattttattcattaatattttaattttattataaattag
TTACACTCCATTTGCAAATGGTCCTGATGATACACCAGAGGAAATATTGGCACGAATAGG
TAGCGGAAAATTCTCACTCAGTGGTGGTTACTGGAATTCTGTTTCAGACACAGCAAAG
gtaagtatcacttcctattataagattttgagaaaataactttttatgatccatagtgag
aagaaatactaccagttagaaacctttgtttataaattagtatgttaaactgatgttaac
aaataatttgaactcgaaaatggacccattattttgtttcttccccagctgacattggtt

 1.17 Intr + 111584 111724  141  1  0   82  105   101 0.883  10.83
atttagcagggaaaaagcggagactgattttttttcccccaaattaccatgttgaccaaa
gggctgctaccagaaaaagcagtatcacagaagctaaggaagaatgttcattagtatcaa
gagccatagaaaaagaagcaaaacaaaaggtttaagcttgttttattattcccattacag
GACCTGGTGTCAAAGATGCTTCATGTAGACCCTCATCAGAGACTGACTGCTGCTCTTGTG
CTCAGACATCCTTGGATCGTCCACTGGGACCAACTGCCACAATACCAACTAAACAGACAG
GATGCACCACATCTAGTAAAG
gtgagcagccccatacagtcactgttttccacaggtcctccaggagagacttcaagaagc
cctgtccatgcccccagcacctttctctttcatcctgcatccagttctgttgtgggattc
tcttacagtgggtgacttcgaaaagctcaaggcatatcaatatattagtaataaaactag

 1.18 Intr + 112313 112403   91  1  1   78   52    67 0.248   0.75
cctccatgttggcctctacagttttggttaagtcagtggatttgaccagtgtggttattt
tcattatgaaccaaataaaatctatgtacatttgcatatgaaaaaactcttcattttgta
tttgtgtacgtgtgactatccattgtcacttttgttactacctttatttcctttgttcag
GGTGCCATGGCAGCTACATATTCTGCTTTGAACCGTAATCAGTCACCAGTTTTGGAACCA
GTAGGCCGCTCTACTCTTGCTCAGCGGAGAG
gtattaaaaaaatcacctcaacagccctgtgaagtgacctcagtgagatatttggtacca
tggtgtaagctgatagcacaagttctggcgacaggtagcacgtatctgagagacacctgc
aagcacacactgtcccagctggtacccataatgctgctgttcctgctgctgctcctgctt

Predicted peptide sequence(s):


>RPS6KA3_1|GENSCAN_predicted_peptide_1|738_aa
XARLSGGRRRRRALSGAAAAAAAAAAAAAAAAAAAAAAAAVGLGRRRSGAGRGAGGEGGG
GEGGGPGGKMPLAQLADPWQKMAVESPSDSAERTLGDYRMIGCVCVIVTDENTVDITNKH
RNTLKVEKEGKQPADLETQENPGNSLFVFFLSPPIYPRQGAMKASKLELPTVTDKKSSEK
KPVSFRQTTGGKVAKINEELILNPVTLNGQQIMDEPMGEEEINPQTEEVSIKEIAITHHV
KEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKDFGLSKES
IDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMKLYRREIHPPFKPATGRPED
TFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHR
NSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQH
PNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQ
GVVHRDLKPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQ
GYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAK
DLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRN
QSPVLEPVGRSTLAQRRX