GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:47:07

Sequence RBM3_1 : 6159 bp : 48.71% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1858   1960  103  0  1   67   76   161 0.950  13.20
attaccaccttattggccgcctttctcagcttttctgtagttacccatattttgttcctc
tttcttgtctattttctgtgctttttctctgctttccgtctcgctattttctcacatctc
cattttctttctccttcctgccaccattcttcatgttcttcccacaggacttgaactgcc
ATGTCCTCTGAAGAAGGAAAGCTCTTCGTGGGAGGGCTCAACTTTAACACCGACGAGCAG
GCACTGGAAGACCACTTCAGCAGTTTCGGACCTATCTCTGAGG
gtgagacgggccatactcacaatgggggttggtgagagaaagtctgggatccttgcattt
caaggagtattaactgaaaagttaggacccacgcctccaaattctttttcttcctaagcc
tatggtgtagactaaggatgaggggaagcgtctttgggattagtgggagcgctccgtttt

 1.02 Intr +   2238   2344  107  1  2   98   59   140 0.999  12.03
caaattctttttcttcctaagcctatggtgtagactaaggatgaggggaagcgtctttgg
gattagtgggagcgctccgttttccctacctatgccatctccttttccggccaccctttg
ctacttaacctttggggtactgactggtccacattgctccatcttctctccctctcacag
TGGTCGTTGTCAAGGACCGGGAGACTCAGCGGTCCAGGGGTTTTGGTTTCATCACCTTCA
CCAACCCAGAGCATGCTTCAGTTGCCATGAGAGCCATGAACGGAGAG
gtggggcctcctatctgcagagggaccttgtccccatctgcggcttccttcattcttttt
gtttttccctctgtgtctgctcggggcagcgtggccaccaagccccgcagtgcccactca
caggagcatgactgccttttgttctagggggtggagggcagcggcagacagagcctggcc

 1.03 Intr +   2991   3096  106  2  1   41  105    75 0.975   4.29
ttctatagctcctgatgaagccattctggggtaaaggagcttattctggaacatggcacc
cagaacctggtgcccagcaggaatttttggcctcttttgcccacttacccttgcctgctc
ttccctcaccattgccctgactgactgccaacccatcatccttgtgtctcccacacttag
TCTCTGGATGGTCGTCAGATCCGTGTGGATCATGCAGGCAAGTCTGCTCGGGGAACCAGA
GGAGGTGGCTTTGGGGCCCATGGGCGTGGTCGCAGCTACTCTAGAG
gtgagtgcagtgatcgttttgatcatggggtgagagggagagttgcctatgtgtggacaa
ctgccatttaaatatttttctgctctaggtggtggggaccagggctatgggagtggcagg
tattatgacagtcgacctggagggtatggatatggatatggacgttccagagactataat

 1.04 Intr +   3185   3281   97  0  1   83   94    82 0.998   7.37
tcagatccgtgtggatcatgcaggcaagtctgctcggggaaccagaggaggtggctttgg
ggcccatgggcgtggtcgcagctactctagaggtgagtgcagtgatcgttttgatcatgg
ggtgagagggagagttgcctatgtgtggacaactgccatttaaatatttttctgctctag
GTGGTGGGGACCAGGGCTATGGGAGTGGCAGGTATTATGACAGTCGACCTGGAGGGTATG
GATATGGATATGGACGTTCCAGAGACTATAATGGCAG
gtgggtagccaaagggctgggatgttctcctattgcttccctctccttaagaactcagcg
cctgggtgttcatgcataccacaccttgctgttactaatgtgtacctaaaatgagtatga
aatttagcattttaagttaattgtgtagtcatatagttgcgacatggtaaagtatactat

 1.05 Term +   3703   3763   61  1  1  115   44    78 0.997   3.38
actgcgtataaatcgtatgccataaaactgtttactgtgatactcatatgcttaacatat
cctgtttttgatacgtaaggtttatgttatgacccatactgtaaaatgtgacgcatataa
ttacagtggtatatataatgcagtaccagaaaacttttgtgtgttttttttcccccccag
AAACCAGGGTGGTTATGACCGCTACTCAGGAGGAAATTACAGAGACAATTATGACAACTG
A
aatgagacatgcacataatataggtgagacttggatatcggcattgagtgaacctgtttg
tcacactctgtcatgaccctctcaccttttctggcaagactgctctgcatttctgctgcc
ctcatacctcacccagccaacctaccaaacattcctagctaggccttccttgctctcagg

Predicted peptide sequence(s):


>RBM3_1|GENSCAN_predicted_peptide_1|157_aa
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDS
RPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN