GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:41:58

Sequence RBBP7_1 : 28080 bp : 42.90% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1184   1414  231  0  0  120    0   109 0.310   2.12
gagcgccgggcgagccctcgcgcctgcgcatcgccaacttcctgccgcggcacgctccgc
ccacccccagaagcccgcctccgaacgccgcgtgaaacccgcccgccgcgcgtcattggt
ctcggcgccggagccgttggctcccagacccgcctctccgcctcctctcacttttcccag
GGCGGATGCGCCTGCGCTCAGCTGCCTGGGCGGGCTGGGAGGCGCGGGTTGAAAAGTCTC
GTTCCAAGTTTGGAGAGAGAGAGAAGAGCGCCTCAGACCTCGGTACCCGCGAGCGGGGAG
GAGGCAGGAAAGAAGGACGCGGCGTCTGGGGAGCACCCAGGCAGCAAGACGGGGCCCGGG
CTTTCGACAGTGGGGAGTGTGACGCGCTTGGGAAAGGCAGGAGCGCCAGCG
gtcgggctgctcttggctaacgagaggagtccgaggcggcggcgaggggcgaacgacccg
acgcaagatggcgagtaaagagagtaagaggccctgcggggcggcgcgcgccggggccgc
ggggggcggcgggcgcgcgaggccgcggcacgcgccggcgaaaggcgcgaattggcgtgc

 1.02 Intr +   1743   2041  299  1  2  109   80   106 0.923   7.57
cacgcgccggcgaaaggcgcgaattggcgtgcggagcagggggcggggccgggcgcgaga
ctgggcgcgcgcctcgaggggcctgcgcgggacgggaccgccgcgccgagggctccgagc
acttccggagccgggcgcggggccgagggctgggcccccctcttcccttccctcctccag
CGGCTGCGCTCCCTCCGGCGCCCTCGGCCCCGGGGCGGAGGCGGCCCCCGCCGCTGGGAA
GCGAGCGCCGCGGCTCTTTCTACGCGCGCGCGCGCGTTGACCGCCTCGGGGTCGCGGCCC
TTGTCCGGGGGTTGCTGGGGTCCTCAGGCCTATGGCTGCCGAGGCGGGCGTCGTGGGAGC
TGGGGCCTCCCCTGATGGGGATTGGAGAGACCAGGCCTGTGGGCTTCTGCTACACGTGCA
TTTGTCTTCCCGACTGGGTCGCGCAGCCCCTGTACGTACAGGTCGTCATCTTAGAACAG
gtgcgaacagctgtaacagggtaaacaatttccatgtccgtgtaattgactacccaacat
ggtgtacgcagggggtattgatctcaatggaaaaaataggcttcctgattgttagtattt
tctccaccttctggaagagcagttagttgtccgtgtccaaattagaggtaaaaggaaaga

 1.03 Intr +   2281   2459  179  0  2   58   69   243 0.979  17.20
tggtgtacgcagggggtattgatctcaatggaaaaaataggcttcctgattgttagtatt
ttctccaccttctggaagagcagttagttgtccgtgtccaaattagaggtaaaaggaaag
agtacatgaggtgtggccatcttgaggtgacctccaatttctgactttgatctatctcag
CCACTTAATCGTGTGGGCTTTCTCCAAATTTCAGTGTTTGAAGATACTGTGGAGGAGCGT
GTCATCAATGAAGAATATAAAATCTGGAAGAAGAATACACCGTTTCTATATGACCTGGTT
ATGACCCATGCTCTTCAGTGGCCCAGTCTTACCGTTCAGTGGCTTCCTGAAGTGACTAA
gtaagggtttctggcaacttttattttgtttaaatttaactgtcgttctgaatttcctag
ttttggcgttttatgcatagaacataagtatgtaatcagcccttgcatgaggtggcaggt
ggtttttattttcaaaacttacgtgatttgtgggatgatttctggtgtatagtgtggtgg

 1.04 Intr +   8435   8580  146  2  2   98   66   144 0.991  12.21
ttatatttgcatatgtggggattgtaaagttggtaaccagagggggagaagatacacagt
tgatgctaagtatatatttgctaaagaaatatgaatgtattttgagggaactagactgaa
tttgttagcaattggagatttcttgtaggattagtgtgacttattttctttcttaaacag
ACCTGAAGGAAAAGATTATGCCCTTCATTGGCTAGTGCTGGGGACTCATACGTCTGATGA
GCAGAATCATCTGGTGGTTGCTCGAGTACATATTCCCAATGATGATGCACAGTTTGATGC
TTCCCATTGTGACAGTGACAAGGGTG
gtaggtatatcatatattccaatattggtgtcaaagggaaaatgtctctttcaaagcata
tgctattaaaactatactattagcttttggcccagtaatttaacttctaggactttattc
tacagaacttcccacccacatgtgcacaaggattttagtcgtaattgcagaattgaaaaa

 1.05 Intr +  12686  12859  174  0  0   57   91   206 0.924  16.79
ataaattgatgtggcaaatgaacccacatttttgggttttctctatgcatgtttctgtct
ttgtcttgtcagtttgtgttgtattctgccaggtcaaaatctgttaggttgattgaacta
agtgatttgtgaattttaatcctgagtgtgtgtgtgtgtgtttctttctcctcacattag
AATTTGGTGGCTTTGGTTCTGTAACAGGAAAAATTGAATGTGAAATTAAAATCAATCACG
AAGGAGAAGTAAACCGTGCTCGTTACATGCCGCAGAATCCTCACATCATTGCTACAAAAA
CACCATCTTCTGATGTGTTGGTTTTTGACTATACAAAACACCCTGCTAAACCAG
gtatgtaataatagagttaggtcattacttgagcagttttcttgattcaaactggtaatg
tttttaaggtcaaagtagcatactttataatatttaaaggtttaaaaattgctttggggg
tcccataaccatcctcaagttcagggatttgccagaactacctaaaagcagcttatacta

 1.06 Intr +  13826  13941  116  0  2   89   47    80 0.915   3.25
taggttttccaaagaaaccaatcatctaatggtcatgaggctcaatttgcattgggtatt
aaagaccagatctcgttcgtgtgcagttgctgtaatggttcactcaatgaaggagtgaga
atttattctcaccagttctgataaacagagaataacttaatgtttttcatcttttcttag
ACCCAAGTGGAGAATGTAATCCTGATCTCAGATTAAGAGGTCACCAGAAGGAAGGCTATG
GTCTCTCCTGGAATTCAAATTTGAGTGGACATCTCCTAAGTGCATCTGATGACCAT
gtgagaaacgtattctttgtaatttgttcatatagtgagagctgacgtgtcacagctgtg
ctgaaggagtactatatagatgaaaggttttctaagataatactgctgattattgtggta
acattcccccaggactttagagagatggttttcatactgccctgtatgagtcttcggatt

 1.07 Intr +  17693  17853  161  1  2  113   67   143 0.999  12.56
ctgtaatcccagctcaggaggctgaggcaggagaatcgcttgagccctggaggcggaggc
tgcagtgagccgagatcgcaccagcctgggtgacagactgagacactgtctcgagggaaa
aaaaaaaaaatcagtctcttatagcccttgttcttttttttttctctccttctctcttag
ACTGTTTGTCTGTGGGATATAAACGCAGGACCAAAAGAAGGCAAAATTGTGGATGCTAAA
GCCATCTTTACTGGCCACTCAGCTGTTGTAGAGGATGTGGCCTGGCACCTGCTGCACGAG
TCATTGTTTGGATCTGTTGCTGATGATCAGAAACTTATGAT
gtaaggtggaaaattcagtgggatcttgttaaatgggtgacctgaatgaccatcagtgat
tgctgcaggctgtagtttgattttttttttttaagttatggctttaaaaaacagctttag
gtagcttactcctgtaatctcaataccttgggaagctgaggcaggaggattgcttgagac

 1.08 Intr +  18660  18786  127  0  1   97    8   105 0.980   3.16
ctctgtaggtttcgaatgtatcatttagtggtcgaggtctgaatcaccagctgtgtggtt
ggtttcttcatgaaggggagcacatagtggagctagttgtggagtgcagtgacagtgatg
tgaggccgaatgtgagtgtgtcatccctgggtgccgtgtgcctttacctttgtgttttag
ATGGGACACCAGGTCCAATACCACCTCCAAGCCGAGTCACTTGGTGGATGCGCACACTGC
CGAAGTCAACTGCCTCTCATTCAATCCCTACAGCGAATTTATTCTAGCCACCGGCTCTGC
GGATAAG
gtttcgaagtttttgcattatttggtgtttataaaacccagttctcttgtgccttaatca
gatatttgaaaattcttaggtaaagcatagaaatcattttcacttgttatttttctttag
accgtagctttatgggatctgcgtaacttaaaattaaaactccataccttcgaatctcat

 1.09 Intr +  18907  19119  213  0  0   80   86   114 0.745   8.39
aactgcctctcattcaatccctacagcgaatttattctagccaccggctctgcggataag
gtttcgaagtttttgcattatttggtgtttataaaacccagttctcttgtgccttaatca
gatatttgaaaattcttaggtaaagcatagaaatcattttcacttgttatttttctttag
ACCGTAGCTTTATGGGATCTGCGTAACTTAAAATTAAAACTCCATACCTTCGAATCTCAT
AAAGATGAAATTTTCCAGGTATGTGACAGTTTTCTGGTGTCTGTATGTCAGGAAATGAAA
TCCAGGGATTCATCAGTTAAGCTATACCAGACTCGTGGGTCCACTATTGAAAAAAATGTC
TTGTACGTGGTGTTACATGGAGATGCTCATAGG
gtaaggtacaccttgttgaagaattaaaaagcttctgggatggttatggggtcgaataaa
tttattgagatcccaggctgagttcctcagtgctggggagtgcagccttcctgaggacag
gatggagctgagcccttgcagagcacttgaaagtcggggacaagagagtgaggccatcag

 1.10 Intr +  19413  19489   77  2  2   55   88    38 0.549  -2.11
aggacaggatggagctgagcccttgcagagcacttgaaagtcggggacaagagagtgagg
ccatcaggccaaggataagataatagagtgcaagatgggaaaatatcagattagaacaac
agccacaaacctagcagcggatgattctttaaatacattttcaaaattatctattactag
GTCCACTGGTCTCCACATAATGAAACTATTCTGGCTTCAAGTGGTACTGACCGCCGCCTG
AATGTGTGGGATTTAAG
gtaacttacagtcctgtgacaagatactgcataaatgtgcctatctggcaagttacatag
tcattcataaactagaaaagcaatttggtaatccccccttcaagaaacctaatattaaag
aaacttctaagcatcttcctaaagagcctttgttctgtaaaatagaagtgaagcagcaaa

 1.11 Intr +  22234  22291   58  1  1   61   80    92 0.740   3.67
aacatagcgaggccatgtctctaaggaaaaaaaaaacctaattgattgtagtatagaaat
aagttgtttttgtgagtgtgtttatgttttaagattactttctgggctgatactggttta
gcagatgttcgtgctacaagaatttcactgatgaaagcgttatattctttattcttacag
TAAAATTGGGGAAGAACAATCAGCAGAAGATGCAGAAGATGGGCCTCCAGAACTCCTG
gtacgcattggcttatagaagatgaaatgtcatatgcagattggattgtcattgatctct
ttatttcgagaatgggtcagaacttcgaattctagctcttgcagatggtttcaaaatgga
ggccctgaaggttattgcaactgggctttgacatttatcaaaaatagtaaatggagccca

 1.12 Intr +  25597  25707  111  0  0   61  101    59 0.873   4.16
ctggaggtttggaaatttgcaaaataagtataaatagattactgagcctgtaccaccttc
taaaaccagacagcacccacccccagttgaaatactgatagctctaaaaacttagtaaaa
cctttgttaggattaacaggagagtatatgaaatcaaagctttttttgttcttgtaacag
TTTATTCATGGAGGACACACTGCTAAGATTTCAGATTTTAGCTGGAACCCCAATGAGCCT
TGGGTCATTTGCTCAGTGTCTGAGGATAACATCATGCAGATATGGCAAATG
gtgagttaaaatgtttttcttgaatgactgtcttgtaaaggagagatttactacttacat
aatgtaataaagttatttcgaatatgtaggtgcatattatgccaaacatttacagaaacc
gtttaaaagaactttttccatttcaacaatacaatctttagtcccatatggtgcttcgtc

 1.13 Term +  26432  26500   69  1  0   83   40    96 0.919   1.26
attacacactggcaaagaatttttcaaaatactggctagcctaccatttccttattgaag
tttttaagagagaaatgtaaaaatgaaactattaagttctaaatagattaaattgttttt
acatgaccatgtgaaaaccatagggagtttttacctgtgaatttatttggttatctccag
GCTGAAAATATTTACAATGATGAAGAGTCAGATGTCACGACATCCGAACTGGAGGGACAA
GGATCTTAA
acccaaagtacgagaaatgtttctgttgaatgtaatgctacatgaatgcttgatttatca
agcgccaaaaaggcattgtatagtaggaaatgtaagtggggtggcttatggcttctttat
cctctgattctagcactttcaagtgagctgttgcgtactgtatcatattgtagctattag

Predicted peptide sequence(s):


>RBBP7_1|GENSCAN_predicted_peptide_1|653_aa
XRMRLRSAAWAGWEARVEKSRSKFGEREKSASDLGTRERGGGRKEGRGVWGAPRQQDGAR
AFDSGECDALGKGRSASAAALPPAPSAPGRRRPPPLGSERRGSFYARARVDRLGVAALVR
GLLGSSGLWLPRRASWELGPPLMGIGETRPVGFCYTCICLPDWVAQPLYVQVVILEQPLN
RVGFLQISVFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEG
KDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECE
IKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQK
EGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLL
HESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTV
ALWDLRNLKLKLHTFESHKDEIFQVCDSFLVSVCQEMKSRDSSVKLYQTRGSTIEKNVLY
VVLHGDAHRVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH
TAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS