GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:48:03

Sequence PQBP1_1 : 7283 bp : 52.93% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    578    685  108  1  0   52   -8   190 0.722   3.97
gatcgtccagcgtgtcttttttcgttaacagggctaggagattacgaagtcaggagaaac
atggcgtggttcggccttcgccgcaccttctctggttgtggcccctcataacggagcccg
aatgacaggaaccgagtgggggtagcgggagatacgttaagagtcccccgagtctggtac
ATGGCTCTGTGCGGCCGATGCCTCCCCCGCCCGACCCCCACGGCTGGCCTTGGCGTCGCA
GCAATATTCCGGATGCCTGTGCCCATTGCCGTACCAGGGCTCCCGAGC
gtactcctccatggcgctggcgtctggccgcgcagtcaggccacgcccccagcgtagacg
cacaccggcgtcggagctttccgcctattaccgggcagcgattgggtcgctataccgcat
gtcacgccaaggacgcactctcattggccaatcgagtttctgccatttgttcattgcctc

 1.02 Intr +   1440   1524   85  2  1  105   85    79 0.885   9.19
gcgatgatattgccacctacctcttacatcttttagtgcgtatgttctgtccacccagct
actggttcatttgagtagatcggagtcagatgagtacatgtttacgggaggcgcttggtt
acgggatccagataggaatctttatctgagctgcttgtcagtttgttcgtctgtccctag
GTCTGTCTGCTATCAGCTATGCCGCTGCCCGTTGCGCTGCAGACCCGCTTGGCCAAGAGA
GGCATCCTCAAACATCTGGAGCCTG
gtgagacagctaaaagcagatggtcctaacacgtgccagcctcgacaggcacttttgttg
ttgatactgacgcttgatacctagcatgggccaactgtgcaccaagcaatggggtggcag
gcatttttcgttgttaacaatgtggattcctgacatccatccctaccgcgtgtcaagtgg

 1.03 Intr +   4132   4243  112  2  1   97   93   233 0.998  24.64
cctaatatagagagttggatttggaatgtgaaagatacttcatattcttcccggcacaca
cacacacgtgtcttttatgtgtggcttgtgtgaatgtgagtgcgtgtctctaggctctac
atgtaggatgaggtcccctggtccttatctgctctcctcatccccaccttgttctaccag
AACCAGAGGAAGAGATCATTGCCGAGGACTATGACGATGATCCTGTGGACTACGAGGCCA
CCAGGTTGGAGGGCCTACCACCAAGCTGGTACAAGGTGTTCGACCCTTCCTG
gtgagcctgggtgagggggagctaacttctggcttcacccttcctgtgctgaccttggtt
gtgaggtttagggggacacaagggagggagcctcgggtggagggtgttggcattaggtat
ctgcaggactcaagttgctgcctgctggggcctggctcctctggggttggaagactgtct

 1.04 Intr +   4872   4984  113  0  2   88  109   109 0.746  13.53
attacaggcatgagccaccacgcccagctgacagtgttttctcttcaggagaagagattc
tggggatcctgcctgtggggtcctgacatggggcaggtataggcagagactggggagaca
agagttgaggatccaaggcaaggacatctgtgctgacacttctttcctgcggccccacag
CGGGCTCCCTTACTACTGGAATGCAGACACAGACCTTGTATCCTGGCTCTCCCCACATGA
CCCCAACTCCGTGGTTACCAAATCGGCCAAGAAGCTCAGAAGCAGTAATGCAG
gtgagttggcaggtacaagcgtgccttgagtgatcttagcagttctcacggagaggccaa
gtagaatgatagtggatcagaggggcaggtgagaccaggcgggcccagcctcaggcaagg
gaggttgttgaaggcagaggctgctgggtcctggggtggcaagaggtcacttcaagactt

 1.05 Intr +   5175   5459  285  1  0   26   98   477 0.935  40.36
aggtacaagcgtgccttgagtgatcttagcagttctcacggagaggccaagtagaatgat
agtggatcagaggggcaggtgagaccaggcgggcccagcctcaggcaagggaggttgttg
aaggcagaggctgctgggtcctggggtggcaagaggtcacttcaagacttgtgtccccag
ATGCTGAAGAAAAGTTGGACCGGAGCCATGACAAGTCGGACAGGGGCCATGACAAGTCGG
ACCGCAGCCATGAGAAACTAGACAGGGGCCACGACAAGTCAGACCGGGGCCACGACAAGT
CTGACAGGGATCGAGAGCGTGGCTATGACAAGGTAGACAGAGAGAGAGAGCGAGACAGGG
AACGGGATCGGGACCGCGGGTATGACAAGGCAGACCGGGAAGAGGGCAAAGAACGGCGCC
ACCATCGCCGGGAGGAGCTGGCTCCCTATCCCAAGAGCAAGAAGG
gtaagctgggcagaatggggctcggtgagaccaacaaggtgcagggtgcactgcgtgagg
aagccttccctcaaaaagatgcctggacctggggctagaggagggtgctgtggtacatgg
cagccaggggcttcatttcttcttgtggggtggggctcagtgatcaggggctcctggtgc

 1.06 Intr +   5674   5737   64  2  1   55  131    66 0.894   5.87
caaggtgcagggtgcactgcgtgaggaagccttccctcaaaaagatgcctggacctgggg
ctagaggagggtgctgtggtacatggcagccaggggcttcatttcttcttgtggggtggg
gctcagtgatcaggggctcctggtgcctctattgaagactttgccctgccacttccacag
CAGTAAGCCGAAAGGATGAAGAGTTAGACCCCATGGACCCTAGCTCATACTCAGACGCCC
CCCG
gtaagtgacaacccctcttgactcagtacgtggacaccatcctccggcctccttcctcca
ttcctcattgggaccaggtgggctgtgtccgccacatcacccatccccatcccctgactc
tttcaccggcaggggcacgtggtcaacaggactccccaagcggaatgaggccaagactgg

 1.07 Term +   5870   6026  157  2  1   88   48   176 0.999  11.32
tgaagagttagaccccatggaccctagctcatactcagacgccccccggtaagtgacaac
ccctcttgactcagtacgtggacaccatcctccggcctccttcctccattcctcattggg
accaggtgggctgtgtccgccacatcacccatccccatcccctgactctttcaccggcag
GGGCACGTGGTCAACAGGACTCCCCAAGCGGAATGAGGCCAAGACTGGCGCTGACACCAC
AGCAGCTGGGCCCCTCTTCCAGCAGCGGCCGTATCCATCCCCAGGGGCTGTGCTCCGGGC
CAATGCAGAGGCCTCCCGAACCAAGCAGCAGGATTGA
agcttcggcctccctggccctgggttaaaataaaagctttctggtgatcctgcccaccat
acctgagtgcttcctttgaggctgcccaacccaagtcggcaagatacacaacacatttta
tttgcaaaaactcagctaagagatagtgtggagctggcaggggctggggggctgagctga

Predicted peptide sequence(s):


>PQBP1_1|GENSCAN_predicted_peptide_1|307_aa
MALCGRCLPRPTPTAGLGVAAIFRMPVPIAVPGLPSVCLLSAMPLPVALQTRLAKRGILK
HLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSP
HDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKS
DRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKD
EELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEA
SRTKQQD