GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:37:32

Sequence PIGA_1 : 18465 bp : 39.92% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    846    970  125  2  2   25   84   109 0.533   2.66
aacaggatgtctagttaaatttacatgtccgataaaaaacgaatgtgtagtgaagtcccc
aatatttggtacatgcttgtattaaacatcatttgtgctttatctgaaattaaaacttca
tagtttcatctgttttgactttttgtgtatttttatttatttatctggcaaacgtcccag
AGCGGTAAGAACCGGCACGGTTTTGCCGTGGCACAGCTGATTACAAACAAAAAGTCTCTC
CAATCAGAAGCAAGCGCGCAGAGAACTGGCGTCCGGAATAGAGACGCTGTAACCAGGAAA
CCAGG
gtgagcacccaccctaccgtcggccgcttctaggagacgggcgcaggcgcgcgctgacgt
tacatctcgcgcttaagggtggggacgacagagcgtctctctcggacgtgacctcagcgc
ctctttgtgattggctgcctcgggggcgcggcccttgggcgcggacgccctagattggtg

 1.02 Intr +   1254   1369  116  0  2   60   39   126 0.575   4.07
ggacgtgacctcagcgcctctttgtgattggctgcctcgggggcgcggcccttgggcgcg
gacgccctagattggtgctgcggaacagcagggagggactccggctgcagccgcgggagg
tccggacactggcggccatggaactcaccggtgagtgcgcgtcgcgccgcccctctccag
CGCTCTGGGCCGCTTTCGGATGGGGCTGTTCTGCGCGCGTGGGATCGTGGCGGGTGGTGG
AGGGGGTGAAACCGACCCGGTTCGAAGCCCGGAAGTTGGGTCGGAGGGTCTCCAGA
gtaggttggggctgagggtgcgtttagggcggacgcgctgggttccttggctcaggcggg
tgggtcgagggactggggtctccggaaccccgggcctgagaccaacgtccactctttggt
tgttttctttctctctttgggcctggccatccccgccatgaacccagcggggtcgctgtc

 1.03 Term +   1693   1883  191  2  2   26   48   114 0.386  -2.17
tggccatccccgccatgaacccagcggggtcgctgtctgagcaggggtatcccctccttg
gcccgagcgtttccccagcgacctctcagggaatcagggaatgaagctcagacagtgccc
aggaattgtcggtggaagtaccattctcttgacccacaactcctgccaggtctccctaag
GTTCTTCAGGAACCTCTACTGCTAATGATTGCCCAGGGCTCGTTGGTCGTGGTCGAGAAT
TTTACGGTAATGTCTTTGCCACTTTAAGTGGCTGGGTGGGAACCTTGGACAAATCACTCA
ACTTGTCTGGGTTCTCATTTGTAAAACGAGAGAGGTATTCACTAGAGCTCCAAGCCTCAT
TTCGGCTTTAA
gagctaagattctgcgattgtgcagcataatgaacttttatgtcaaagatgtttggactg
aaaacctggcggaagtgggcagactcctcacagaacgttgcaggctaatgacaacatttt
aaatgatatcatttggttcattactcactgtttttgctatcgttcatcttttaaaactgg

 2.01 Init +   4794   5508  715  2  1   91   90   473 0.657  42.08
tttaattctggggaaagctaacaaatttacattaacattaaaacaatatctatatctgga
tttgtaatatggaatgtgttttgtttctgagctgagatcctgttttactctttttcaggt
aatagaggacacatctcttaactgggttgctctaagaactgatgtctaaaccgtctcagc
ATGGCCTGTAGAGGAGGAGCTGGGAATGGCCACCGTGCCTCAGCTACACTCTCTCGGGTT
AGCCCTGGAAGTCTTTACACATGTAGAACCCGTACCCATAATATATGCATGGTATCTGAC
TTTTTCTACCCAAATATGGGAGGCGTGGAAAGCCACATTTACCAGCTCTCTCAGTGCCTG
ATTGAAAGAGGGCATAAGGTTATAATTGTCACCCATGCTTATGGAAATCGAAAAGGCATC
CGTTACCTCACCAGTGGCCTCAAAGTCTATTACTTGCCTCTGAAAGTCATGTACAACCAG
TCTACAGCCACGACCCTCTTTCACAGTCTGCCATTGCTCAGGTACATATTTGTTCGGGAG
AGAGTCACGATAATCCATTCACATAGTTCTTTTTCTGCTATGGCCCATGATGCTCTCTTC
CACGCCAAGACAATGGGGCTTCAGACAGTCTTCACGGACCATTCCCTTTTTGGATTTGCT
GATGTCAGCTCGGTGCTTACAAACAAGCTTCTAACCGTGTCTCTTTGTGATACAAACCAC
ATCATTTGTGTGTCTTATACTAGTAAGGAAAATACTGTACTAAGAGCAGCACTGAATCCT
GAAATAGTGTCCGTCATTCCTAATGCTGTAGATCCTACTGACTTCACTCCAGACCCATTT
AGAAGGCATGATAGTATAACTATTGTTGTTGTCAGCAGACTTGTTTACAGAAAAG
gtaatgaaatgatagctataattgcattgtagacttttttccctatagaaagctgttgaa
tacttgtatataatgattgtttggcttttcattttgttttatggttttataatgctataa
attatagcaaagaaagttctaatattggtttatatatccaagaagagcgatttttcagga

 2.02 Intr +   8411   8503   93  0  0   86  110    28 0.920   3.82
gtgagagagaggataaatcaaagttttccttatccaggctttttggatgtctttttcctg
agcctcctcttccaagcctgttttgctctcagtcaggatttaccagcactctgcatgtgt
aggcacgctcacctgcttccttctgtagtggtaatgacaacctacatttgtattctgcag
TTGATAAAGCCTGTTCGTGGTACAATACCTCATTTGACCCTCCCAACAACTGTAGGGTAG
ATGTTATCTACATGAAATTGAGTCTCAGAGAGG
gtaagtaactcacccaggttacacagtaagtaacagagatgacacacgagttcagctttt
ctggagctaagttctcctcttcctccacccatgcccagccactcatatcctaggtgtaga
tcagaaggttcttaaaaatattgttagactgagctttaaaagcagtttggatcagagatt

 2.03 Intr +  10678  10810  133  2  1   71   72   109 0.987   6.38
tcttgggggaccactgccagtttgcaaacaattccactcctggaaaaggtttaagagagt
ttctctcctttatggagtgcatagctaatacttttcaaaataagtggattctcagtcgtt
ctggtgaatttttttaagtttaaatattaatatctccaacattcaactttatattttcag
GGATCGATTTGCTTAGTGGTATAATACCTGAACTCTGTCAGAAATATCCAGATTTAAATT
TCATAATTGGAGGAGAGGGACCAAAGAGAATCATTTTGGAAGAAGTTCGGGAAAGATACC
AGCTGCATGACAG
gtattgatgaatttcatgttgtcttgagggagaagatgtcaattatctctatttggtttt
aactgcatgcgtaccttaggtgtgttgcttctcctgcatgtaattgatatacatataatt
gatataaatctaatgcaaggactgttttcaaaatttttatataaataggaaacctagtta

 2.04 Intr +  11572  11704  133  1  1   34   98    89 0.998   4.23
aactgctttataaggctgtttctattagatcagtgtttggtgatactaatcttgaggtgg
agaacattagcagcaataagaatttaagtgtaatataaatagcagacttggtttataaat
taaatttcttttgtagcatgagttttcactcctttcttcccctctcatttaaaaaatcag
GGTGCGTCTTTTGGGAGCTTTAGAACACAAGGATGTTAGAAATGTCTTAGTTCAAGGACA
TATTTTTCTGAATACCTCCCTTACTGAAGCATTCTGCATGGCGATCGTGGAAGCAGCCAG
TTGTGGTTTACAG
gtaaaaagctttgagggcattcatggttgggatttctgtgtattttgaaaaataatgaga
cacattccataataatgttttaactggttttgttgatcttcctgaggtatgattatggtg
gagtatgtgttctttctttctttttaaggttgtaagtaccagagttggtggaattcctga

 2.05 Intr +  11853  12059  207  2  0   88   95    96 0.995   8.65
cgatcgtggaagcagccagttgtggtttacaggtaaaaagctttgagggcattcatggtt
gggatttctgtgtattttgaaaaataatgagacacattccataataatgttttaactggt
tttgttgatcttcctgaggtatgattatggtggagtatgtgttctttctttctttttaag
GTTGTAAGTACCAGAGTTGGTGGAATTCCTGAGGTGCTTCCAGAAAACCTTATTATTTTA
TGTGAGCCTTCAGTAAAATCTTTGTGTGAAGGATTGGAAAAGGCTATTTTCCAACTGAAG
TCAGGGACATTGCCAGCTCCAGAAAACATCCATAACATAGTAAAGACTTTCTACACCTGG
AGGAATGTTGCAGAAAGAACTGAAAAG
gtatgtcacatgctgagaaaagattgtgtctgaactcttacttgatgtttcacgtacaca
tttgctttttcttacatagatgtttaccatttttgttctattgcttaagttgatgaaatc
tcttccaggtgaaaagaaacagattttggtacacacaccgggctaagtgtctggtcaaat

 2.06 Intr +  14498  14644  147  1  0   42  -33   179 0.523   0.71
actgaaatttcccccatctctttatcttcttttatttgaaatccatgaaatgcttctgca
tgtcctcaccatccatgctcagcaacatgtacagcctcatgtggctgttgaaagaggagg
ctctgtgttcccagaagtatgctagattgtagctctctgcttgtggttgatgtctgccag
ATGCCGGTGAGAGCATCTCAGCTTAGTCAAGGAATCTTCAAAGGCAAATCCTGCTTCAGT
ACTGCTGAAGTCACTGCTGAATTAAATATTGACCCTACAGTGGTGACCCCAAAAGCTGTT
CAGACTTTGCGGGACTTTGGAATTCTA
gtagttggctaaaattgatggtgactccctaggggagaggaactgtggcttattctttgt
atcacacagcctctagcccggtgtcttgcccagaataagtacccaataagttttgaatca
aatggcaataattatcgtgattaagttcattaaggatatcattactatgacaacaacaac

 2.07 Intr +  14952  15214  263  2  2  118   75   225 0.127  19.56
ataattatcgtgattaagttcattaaggatatcattactatgacaacaacaacaaaacac
aagcaacttttgtttgtatttgtttataaaatgttcctgcaggatcgggtcattgtttat
catgggacaggtgatggggtgatgggtgaaagtgctcacacttggcttctctccctccag
GTATATGACCGGGTATCAGTGGAAGCTGTGTTGCCAATGGACAAACGACTGGACAGACTT
ATTTCTCACTGCGGCCCAGTAACAGGCTACATCTTTGCTTTGTTGGCAGTTTTCAACTTC
CTCTTCCTCATTTTCTTGAGATGGATGACTCCAGATTCTATCATTGATGTTGCAATAGAT
GCCACTGGGCCACGGGGTGCCTGGACTAATAACTATTCTCACAGTAAAAGAGGGGGTGAG
AATAATGAGATATCTGAAACCAG
gtagaaggaagcctagattgtaagattttaaacatttgtaatagttctataaagactatg
gaaaataaccttgcttttggggggtttttgtttttttagagttaatttagtaagttatgc
tacctctatatcattcaatattttctgttgaggaaagataaaaatgtatgcaattcctga

Predicted peptide sequence(s):


>PIGA_1|GENSCAN_predicted_peptide_1|143_aa
SGKNRHGFAVAQLITNKKSLQSEASAQRTGVRNRDAVTRKPGALGRFRMGLFCARGIVAG
GGGGETDPVRSPEVGSEGLQSSSGTSTANDCPGLVGRGREFYGNVFATLSGWVGTLDKSL
NLSGFSFVKRERYSLELQASFRL

>PIGA_1|GENSCAN_predicted_peptide_2|564_aa
MACRGGAGNGHRASATLSRVSPGSLYTCRTRTHNICMVSDFFYPNMGGVESHIYQLSQCL
IERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYNQSTATTLFHSLPLLRYIFVRE
RVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNH
IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKVD
KACSWYNTSFDPPNNCRVDVIYMKLSLREGIDLLSGIIPELCQKYPDLNFIIGGEGPKRI
ILEEVRERYQLHDRVRLLGALEHKDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVV
STRVGGIPEVLPENLIILCEPSVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRN
VAERTEKMPVRASQLSQGIFKGKSCFSTAEVTAELNIDPTVVTPKAVQTLRDFGILVYDR
VSVEAVLPMDKRLDRLISHCGPVTGYIFALLAVFNFLFLIFLRWMTPDSIIDVAIDATGP
RGAWTNNYSHSKRGGENNEISETX