GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:05:59

Sequence NXF2_1 : 105092 bp : 42.51% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    637    773  137  1  2   85   47   194 0.525  14.29
ctctatggccttgggtcactggccacagtaccattattcataagttgaaataggactgtt
tgtttttaaggcttcttctgactctcaaatactctgcttttatggctccttgcttggatt
ccacccttccagactagatttcctttaatagtgtaaatgttctgtttctccctacggcag
GGGCATCCTCCGTGTTCTGGGCCTAATGAAAATGGACATGGTGAACTATACCATCCAGAG
CTTTCGACCCTACCTGCAGGAACATTCCATCCAGTATGAACAAGCTAAATTCCAGGAACT
CCTTGATAAACAGCCCA
gtatgtttaaaattcaagggcaggagaggggagatttgacctcaggtctgccttcttata
gcaatagaggctattttctattttttgaatagaaagtttcttccttgggcaaggggtagg
gagaaggaatgtttctctaagatagaaagatctacaaaatcacttctttatagaccaaga

 1.02 Intr +   1020   1240  221  1  2   92   75   117 0.968   7.90
gaggctattttctattttttgaatagaaagtttcttccttgggcaaggggtagggagaag
gaatgtttctctaagatagaaagatctacaaaatcacttctttatagaccaagagtatgt
ctcagagccatcatctttaagccttggaattttaagatgcatattcccttctcgtcgtag
GTCTCCTCGATTATACCACAAAATGGCTAACCAAAGCAGCCACAGACATCACTACACTAT
GTCCGAGTTCTCCTGACTCACCTAGCTCCTCCTGCAGCATGGCGTGTTCACTTCCAAGCG
GGGCAGGTAACAATTCAGAGCCCCCCAGTCCAACAATGGTGCTATACCAAGGCTACCTGA
ACCTCCTCCTCTGGGATCTTGAAAACGTAGAATTCCCAGAG
gtagggatgtgtgtttgggcattgccttgttctatggtattcagtgcctccattcaaacc
ctcctcttctgatgggctgtccttcgctccctcaccagactctgctgatggacagaatcc
ggctccaggaactggcattccagttgcaccagttaactgtcctggcctcagtcttgctag

 1.03 Intr +   1339   1520  182  0  2  101  110   123 0.998  13.54
gccccccagtccaacaatggtgctataccaaggctacctgaacctcctcctctgggatct
tgaaaacgtagaattcccagaggtagggatgtgtgtttgggcattgccttgttctatggt
attcagtgcctccattcaaaccctcctcttctgatgggctgtccttcgctccctcaccag
ACTCTGCTGATGGACAGAATCCGGCTCCAGGAACTGGCATTCCAGTTGCACCAGTTAACT
GTCCTGGCCTCAGTCTTGCTAGTGGCCAGAAGCTTCTCTGGTGAAGTTTTATTCAGATCA
CCTGAATTTGTGGATAGACTGAAATGCACCACCAAGGCCCTAACTGAGGAATTTATCTCC
AG
gtaagattcatagatctctgttagagagggaaatgtgtggtatttgggacataggtaata
tcaatactattattgcttattcttcatcacaaaccacacaaaggcccttggaaatgatct
tcaaagattttggtatctttgataatttgtattgaggtttgggatacagaaaataaaact

 1.04 Intr +   2282   2520  239  2  2  100   82   182 0.667  15.14
tggatcaggtggtaccttgcgggtaacaatgagtgtatttcatctgcccagtggctaatg
ctgtcttctggtggcagagagccagaattcttcctggaataggcctggcttgtggtatga
ggctctctgggctttgcccctctgccaggcccactctgcattctatcccttattatctag
GCCTGAAGAGACTATGCTGAGTGTGAGTGAACAGGTGTCTCAGGAAGTCCATCAAGGCCT
TAAGGACATGGGCCTCACTACTCTGAGCAGTGAAAACACAGCATCTCTTCTAGGCCAACT
CCAGAACATCACCAAGAAAGAGAACTGCATTCGTAGCATTGTTGGTAAGAATCTCCATGG
TCGTCGTGCAGAAAAGTGGCAAGAATGTGGGGCATGGGTGGGTAGACCTTACCCTGAAT
gtgagttacctaagcatttaaaaatgaaaaggcatgatcatttgggaagttttttagctt
tagtttcctcgtctataatgtgcactgttcaaatagatctttctcaatttggagaatgca
tgtatggtttgaagacagctctgtacccaagatatgtcattcacaggtgttggatattat

 1.05 Term +   3621   3853  233  1  2  111   44   129 0.863   6.45
atggcattccattcccccaaacaaacaaaaatctcatgtatacggtttacccaaatgagc
agagaggtcagtgaataactcggttaatgcaaaactttggtgagcagatagagcaaaggc
attgtgaatttcttctgtaccgtcttcgttcctcttgtcattgtttttccctgctcacag
ATCAGTGGATCCGTTTTTTTCTCAAATGCTGTTTGCTTCATGGCATGCAGGAGTCTCTGC
TACACTTTCCTGGAGGCCTCATTCTCATTGAAAAGGAGTTGGCAGAACTGGGCTGGAAGT
TTCTCAATCTGATGCATCATAATCAGCAGGTATTTGGCCCATACTATGCTGAGATCCTAA
AACACATCATCCATCCAGCTCAAGCACAAGAAACAGATGTGGAGCCTAACTGA
tagtgctggaccccagctatggcaacagggactcaggagagagaggtcagcatgtttctg
ggaggacatcacctgtggttagtcgaacagtcagccctcttcctcgctatagccaggaca
cagggatgcaggggtcaagcatgtaagcaccaactggcccaatccccttcactaataaac

 2.04 PlyA -   5980   5975    6                               1.05
 2.03 Term -   7057   6840  218  2  2   33   41   173 0.273   3.42
 2.02 Intr -  10258   7962 2297  0  2  -47   47   696 0.046  38.38
 2.01 Init -  10494  10331  164  0  2   70   60   118 0.138   6.45
 2.00 Prom -  10568  10529   40                             -15.32

 3.02 PlyA -  10603  10598    6                               1.05
 3.01 Sngl -  11353  10697  657  1  0   49   41   340 0.902  21.32
 3.00 Prom -  11446  11407   40                              -6.15

 4.01 Init +  14474  14480    7  1  1   54   96     5 0.113  -1.23
accccattttctctttgtctcacacactctatcaccatgtgacaccttcaatgtaccctg
ccagatactggtgccatgctcttgagacttcccagccgccagaacagtgagccaaataaa
attgtcttctttataaattgcctagcctgtgcattctgttatagcagtagaaaacagact
ATGGCAG
gtaggtagacatattacccaaagagaaacacatctgaaaaatatacaccaatctttttac
attgaatatgtatgcatcacagtgatgggatcatatagatggaagatgtagaatgatttc
atcttctaaatatacatttataatgtttagtattttttaattaggaaaatttcttgagag

 4.02 Intr +  17433  17612  180  1  0   81   31   176 0.596  10.12
tgctaggctcagtccacccagcagctctcacaggttggagtcttgttcctccagctctcc
cagggtatcattaaatgccagtagctctgaaattctggaatcttagtagcagtccagctc
ccacacctctactagacattacccgaattgggactctctgcaactgacttgttcccacag
CCCCATCAGGTACTGGCCTGATGGGGACTCTCTCTGGCAGCTCTGCCCCTGTGGCAGGTC
TCTACATGGGTCCTCAGGCTGTCTGCAACATTCTGCGAAATCTAGGTGGAGGCCGTCACA
GACCCATAGCTCGTGAATGCTGTGCACCTGCAGAATCAGCACCATTTGGATGCCGCCAAG

gtccaccgcttgagccttccagaccggcagcctgttcagcacccggccccccttgaacta
tggctgggacagccgaggagtgctgcacgaaggtgcgggcagcagacacttaaaagcatc
acggggcagcagatgttgaggtcccgtgggcgtctctctggaaactttgccttcgcattg

 4.03 Term +  21503  21792  290  0  2   81   48   209 0.982  10.75
aaaggcaagtttatgattacacctactaatcgaggaactgcttgctctgcaaccagtaga
tgatcacgagatggtcagatcttggtaggcccacaagagatgtcaaaataaaattctcaa
aaataaacatcctagagacctccagttctggccaagctggagtttgccctttcctcccag
ATGGTCCCTCTACATCAGAACACCCTGAATATAACAGCAAACCAGCAAAGAAAGCTCTGA
AACGTGGAAAGGGGAAAGCAGACCGACTCATGCTCTCAGGACTCGAGCAAGAACACAGGC
AGCGCATTCCCTTGGTTTTTCTATTTCCACCCAATATCCCAGACAGGGCACCGCAGAAGC
CCCCAGTCCAGAACCACCAACAATGGCAGACACAAAGCTCCAAGAAAAGCCTATTTCCTC
TGCCAAAAGACCATAAAAAACGTGATCTAAAAACTGAAAAACCTTTGTGA
caaattcccctcccctacactagacaaacaacaatggaaaaaccttatctcccccacccc
ccaaggtttcagggaacaagaaggaaacttgtcttctatcctgcctctctgaggcagatg
gtgatgatccaattcacctgtcagggtagtgtcagtggtgtccagcagcaagatgagcct

 5.01 Init +  36460  36614  155  0  2   80   73    86 0.496   5.80
taaagcaggttcatgtcaatggaccaaaaggtgccagccacactgctagagctcgctgca
tggagtctgctgagtgatgagcctgcagctatccatgctcttgaggagctcccatgagac
ctctttgttccattgttcatcactgccttcttgggtgggcagaagatgaaactaaaggcc
ATGGTGAGGATTTGGCCCTCCCGTTGTCTCCATGTTGGACCGTTGAGTGTAAGGGAGTCA
CACTATGAAATCTTGGGAGCCACGATTGATGGTCCTGCAGATCCTCCCTGCCCAGAGCTC
TTCCCCTCGGTAACCCTATGTACACTAGAGACATA
gtgagtcatcaggagggtatgctgcagcctgaggcagggggtggcctaacagtctcccaa
aggtggttgacggtgaatgctgaggatctctgtgaggttgttggtccaacacttggggtc
accttaaggactctaatgtcttacagaggtgattatggaatagaggtgattgagagtact

 5.02 Intr +  37768  37879  112  1  1   69   15    71 0.024  -2.64
gaacaacctccaggaactcagcttgtcttgcttctgcctcacagatcagctggacaaaat
ttccgggtgagaggttggggagggacctgggttccctgaatgccccattacgaacaaaag
agtgcgactattcttagatattcttaaacactttgtaacctatttctccttccacatcag
CACGGGCACTGCTGGGTGTTTTAAACTGGCCAAGCTAGAGAGTGTGGTCCCTCATGCTGA
GGAGAAAGACAGGATTAGAAAAGTCAGCTGTGCCCAGTCAGTCAGTCAGTCA
gtcagtcaatcaaccatgtgcagacgtgcagacactaagataagtctgtcgacatattgg
cgaaaaagacaacagtcctgcttttattggagtgtgtagccttctagagaggaaggggag
gcattcagtcggagaaataactgacgctgtagcactgatgcacatccccatgggctggtc

 5.03 Term +  39144  39428  285  2  0   83   48   169 0.679   6.82
tcattgaaggtgatgctgcaggcagtaccacagaacgacatgaactagaccacccattct
cagtgatcttcacaggacaaggagttgtttcatcactgatgtgtggccactaaaatactg
agtgttcttgcctgaagcccaatttgtaaagacacataatgtgccattctgctattccag
GAAACTGGTGTTAGGAAGATTGGATATGTAACTGACCTCCATAAAAGAAAAACTCTAAGA
AGGAAACAGCAGACTTTACGAAGTCTTGTGGGTCTCTTGCCCATTGTCCTCTACGTCCTC
CTTCTTGTTACTGACCACAGTGTTGGGTACGTGACATGGGCTGACCCAGTCGTGGCACAC
CATTTCCCTGTCCACACTGATCGGTTCACTTATGGGTACTTGACGCAAGTCAGGACAGTT
GAAACCTTTCCTGGATGTTTTTCTGGAGTAGGTGCTGGTTACTGA
agccaataatattactcactgaggtcctttaatcttcctgtattcatgattgccttaggt
tgcttatgacaaaccattggcaattaaaatgaaaaacaagaacaacaagaaacaaactat
ccccactacctactggtgtctttatcagtatattgctatctcctttcctaggtctcagaa

 6.01 Sngl +  42666  44006 1341  2  0   56   42   506 0.986  38.66
caaatgctgagggattttgtcaccaccaggcctgccctaacagagcttctgaaggaagca
ctaaacatggaaaggaacaaccggtaccagccactgcaaaaacatgccaaagtgtaaaga
ccatcgaggctaggaagaaactgcatcaactaacgagcaaaataaccagctaacatcata
ATGACAGGATCGGATTCACACATTACAATATTAACCTTAAATGTAAATGGGCTAAAGGCT
CCAATTAAAAGGCACAGACTGGCAAATTGGGTAAAGAGTCAAGACCCATCAGTGTGCTGT
ATTCAGGAAACCCGTCTCACGTGCAGAGACACACATAGGCTCAAAATAAAGGGATGGAGG
AAGATCTACCAAGCAAACGGAAAACAAAAAAAGGCAGGGGTTGCAATCCTAGTCTCTGAT
AAAACAGACTTTAAACCAACAAAGATCAAAAGAGACAAAGAAGGCCCTTACATAATGGTA
AAGGGATCAATTCAACAAGAAGAGCTAACTATCCTAAATATATATGCACCCAATGCAGGA
GCACCCAGATTCATAAAGCAAGTCCTTAGAGACCTACAAAGAGACTTAGACTCCCACAGA
ATAATAATGGGAGACTTTAACACCCCACTGTCAACATTGGACAGATCAATGAGACAGAAA
GTTCACAAGGATATCCAGGAATTGAACTCAGCTCTGCACCAAGTGGACCTAATAGACATG
TATAGAACTCTCCACCCGAAATCAACAGAATATACATTCTTTTCAGCACCACACCACACC
TATTCCAAAATTGACCACATAGTTGGAAGTAAAGCACTCCTCAGCAAATGTAAAAGAACA
GAAATTCTAACAAACTGTCTCTCAGACCACAGTGCAATCAAACTAGAACTCAGGATTAAG
AAACTCACTCAAAACCGCTCAACTACATGGAAACTGAACAACCTGCTCCTGAATGACTAC
TGGGTACATAAGGAAATGAAGGCAGAAATAAAGATGTTCTTTGAAACCAACGAGAACAAA
GACACAACATACCAGAATCTCTGGGACACATTCAAAGCAGTGCGTAGAGGGAAATTTATA
GCACTAAATGCCCACAAGAGAAAGCAGGAAAGATCTAAAATTGACACCCTAACATCACAA
TTAAGAGAACTAGAGAAGCAAGAGCAATCACATTCAAAAGCTAGCAGAAGGCAAGAAATA
ACTAAGATCAGAGCAGAACTGAAGGGGATAGAGACACAAAAAACCCTTCAAAAAATCAAT
GAATCCAGGAGCTGGTTTTTTGAAAAGATCAACAAAATTGATAGACCGCTAGCAAGACTA
ATAAAGAAGAAAAGAGAGAAGAATCAAATAGATGCAATAAAAAATGATAAAGGGGATATC
ACTACTGATCCCACAGAAATACAAACTACCATCAGAGAATACTATAAACACCTCTATGCA
AATAAACTTGTAAATCTAGAAGAAATGGATAAATTCCTCGACACATACACTCGCCCAAGA
CTAAACCTGGGAAGAAGTTGA
atatctgaatagaccaataacaggctctgaaagtgaggcaataattaatagcttaccaaa
caaaaaaagtccaggaccagatggattcacgcccccgaattctaccagaggtagaaggag
gagctggtaccattccttctgaaactattccaagcaatagaaaaagagggaatcctccct

 7.01 Sngl +  44451  45884 1434  2  0   19   48   569 0.128  41.55
ctgatgaacatcgatgcaaaaatcctcaataaaatactggcaaaccaaatccagcagcac
atcaaaaagcttatccaccatgatcaagtgggcttcatccctgggatgcaaggctggttc
aacatacacaaatcaataaacgtaatccagcatataaacagaaccaaagacaaaaaccat
ATGATCATCTCAATAGATGCAGAAAAGGCCTTTGACAAAATTCAGCAACCCTTCAAGCTA
AAAACTCTCCATAAATTAGGTATTGATGGGACGTATTTCAAAATAATAAGAGCTATCTAT
GACAAACCCACAGCCAATATCATACTGAATGGGCAAAAACTAGAAGCATTCCCTTTGAAA
ACTGGCACAAGACAGGGATGCCCTCTCTCACCACTCCTATTCAACATAGTGTTGGAAGTT
CTGGCCAGGGCAATCAGGCAGGAGAAGGAAATAACGTGTATTCAGTTAGGAAAAGAGGAA
GTCAAATTGTCCCTGTTTGCAGATGACATGATTGTATATCTAGAAAACCCCATCGTCTCA
GCCCCAGATCTCCTTAAGCTGATAAGCAACTGCAGCAAAGTGTCAGGATACAAAATCAAT
GTGCAAAAATCACAAGCATTCCTATACCCCAATAACAGACAAACGGAGAGCCAAATCATG
AGTGAACTCCCACTCACAGTTGCTTCAAAGAGAATAAAATACCTAGGAATCCAATTTACA
AGGAACGTGAAGGACCTCTTCAAGGAGAACTACAAACCACTGCTCAATGAAATAAAAGAG
GATACAAACAAATGGAAGAACATTCCATGCTCATGGGTAGGAAGAATCAATATCGTGAAA
ATGACCATACTGCCCAAGGTAATTTATAGATTCAATGCCATCCCCATCAAGCTACCAATG
ATTTTCTTCACAGAATTGGAAAAAACTACTGTAAAGTTCATATGGAACCAAAAAAGAGCC
CGCATTGCCAAGTCAATCCTAAGCCAAAAGAACAAAGCTGGAGGCATCACTCTACCTGAC
TTCAAACTATACTACAAGGCTACAGTAACCAAAACAGCATGGTACCGGTACCAAAACAGA
GATATAGACCAACGGAACAGAACAGAGCCCTCAGATATAATGCCACATATCTACAACTAT
CTGATCTTTGACAAACCTGAGAAAAACAAGAAATGGGGAAAGGATTCCCTATTTTGGAAA
TGGTGCTGGGAAAACTGGCTAGCCGTATGTAGAAAGCTGAAACTGGATCCCTTCCTTACA
CCTTATACAAAAATTAATTCAAGATGGATTGAAGACTTAAATGTTAGACCTAAAACCATA
GAAACCCTAGAAGAAAACCTAGGCAATACCATTCAGGACATAGGCATGGGCAAGGACTTC
ATGTCCAAAACACCAAAAGCAATGGCAACAAAAGCCAAAATTGACAAATGGGATCTAATT
AAACTAAAGAGCTTCTGCACAGCAAAAGAAACTACCGTCAGAGTGAACAGGCAACCTACA
GAATGGGAGGAAAATTTTGCAATCTACTCATCTGACAAAGGGCTAATATCCAGAATCTAC
AACGAACTCCAACAAATTTACAAGAAAAAAACAAACCACCCCCTCAACAAGTAG
gcgaaggatatgaacagacacttctcaaaagaagacatttatgcagccaaaagacacatg
aaaaaatgctcatcatcactggccatcagagaaatgcaaatcaaaaccacagtgaggtac
catctcacaccagttagaatggcgatcattcaaaagtcaggaaacaacaggtgctggaga

 8.06 PlyA -  46811  46806    6                               1.05
 8.05 Term -  50141  49990  152  0  2   62   40   115 0.522   1.19
 8.04 Intr -  51870  51653  218  2  2  -53   15   498 0.491  25.62
 8.03 Intr -  63441  63325  117  2  0   68   93    47 0.318   1.86
 8.02 Intr -  63791  63580  212  2  2   31   56   127 0.130   0.59
 8.01 Init -  65733  65692   42  0  0   75   93    53 0.195   4.97
 8.00 Prom -  66770  66731   40                              -3.05

 9.01 Init +  71603  71725  123  1  0   54   55    82 0.381   1.72
aaaagaagtctgttgaaaagatacactatggaccttgggctcaaagacctacggtaggaa
gctctgagtaggatgtgagaaaaatcaatgtgacagtgaaaaacaattattatgtacaac
tcttttatattctaaagaagggggttaagaataaagatccttgatgtgctgatcagggtg
ATGAGTCTGAGGATTCAGTCATCAGAATCTCACAGAGATAAATGGCTCCACAGAGAAAAG
AGATTTGAAGGGAATGAGACTGTTCAGGAAGAACAGGAGCTGATGCCCATCCATCTCATG
AGG
gtatgaggaagagaggcaagatagtctaacgcagactgtttggtgacatttcactgggac
acgtgccattgaatctcccccgtttgtccccatgaagacgtctacaaatgcgcattgaat
gttttggtaatcagatttatcattggtttgggggtggggggtgaatttcagcatctactg

 9.02 Intr +  72421  72556  136  0  1   28  131    84 0.376   5.92
tctcccaacatggatcacttctcagtcattgagaagggaatatgagaggaggtctagatc
attatgttcttatttggcagtttaattgttaaaaggaacattcaccaatatactcccacc
tcgacacccacagaacgtaaaaataaactgttgtaggatgtggtacagtggctcttacag
GGTATACTAGAGAAGAATGAGGATGTGAAGAAAACTGGGGTTCACATTGAGCCTGGGGTG
GAAATCCTGGCTGTTCAGGGTGGTGGAAAGTGTAGGGCTGATTGCCATTCCTATGATGCC
TTCCTTGAATCCTCCG
gtaagtatccacatcttctagtctctgacttcgaccatatttatcacctctaataccaga
gttctgaagtttgtttcttgctggattagtttctgtggtcttctaaggacttatgaccta
tacgtctgttttatagcctataaaattttgctaacatatttttcttggtgtggtgtcgtt

 9.03 Intr +  79738  79801   64  2  1  101   93    23 0.287   0.96
aaagttaatttacataggacacctagttcaggtgtatgtatctgttcaaaccaaaagcgt
tagagtatttatgtttaatttaacaacgtcgcaaccgttctgatacttaggggagttctg
agtaagtaagttctagaaaggggagttccagtactcccctttctctcttttctgtgttag
GTAAAGCCACCCCTCCTAAAGCCACTAGCATGGATCCCCAAAATGTCCACCACAGAACGA
AAAG
gtaaaagaaggagaagttgttcctgttaaatcctgccgtatcacacgcaagagaaatggc
ttatcaacctgcctcaccccagtaaacacagcgcctaataaattcagtgcctaaactgga
ccccggacatatgaatctttgtccacagagttaccttcccccactgtttgtgcatattag

 9.04 Intr +  82816  82970  155  1  2  -16   36   205 0.088   3.69
cacgtgaagattgtgagctgccaaactctgcagatgtgtgtgtgggcagccaagtggctc
ctgtcatctcgtggcaggcaaagcctttgcggtcctgtgagcaccgcagctaaccaatgg
ctgttgtacatgtggctcttatggtcacgtgagattccgcaccctcccattcacgtgaag
ATTGAGTGCTCCGAATCCTGTCAGAGAGGTGCTTCCGGCTCCACACCCTGACTCAGGCGG
AAGTTTTATTGGACTTCGGCTCAGATCTGAAGCCTTCCGGCAACTTTCATATCCTGACGC
GCTGGAAGGAAGTCTGGTACGAGTGGAACCAGCCG
gtactagaagtttactgagaattgggctttaaggcgtggctgagcaatctccaaatagca
gaggctctgagggggtggggtggggtggggtgggtggggggtgccgggggtgcgggaggg
tggggggtgcgggaggtgcgggagggtgggggggtggggagggtggggggtgcgggaggg

 9.05 Intr +  84250  84345   96  2  0   97   92    -3 0.165   0.06
ggtgataacatttggtacatcatgaaagcggtattgggtgaatgaagttgagcaaatagc
aagattgtgcttaaacttacggggtttcaaatattgcttgtcagatggttagagaatatt
gtcacttgtgatatttgatattacatgtaggttgaataatctatttttctctcatttcag
CATTTCCAAGTTCGTTCTGTGAGACTGTAGTGTCAGGACAAAGCAACAACAAAATGTGCT
CTACTCTAAAGAAGTGTGGGACATACAGAACTGAAG
gtaaacgaatactgtaggatttttttagatgatatgctaataaacaacacgagtctcaaa
gggggggctactttccccaacttgtatgggaatggaacatttttttccacagagcatttg
aggtaccagtgttcttcagaaaatatttggggaaaccctgttcagactacatcttctaac

 9.06 Intr +  85379  85518  140  0  2   28   97    67 0.075   0.86
agacccaaactaatggagcagccaccatctagaaaggggttactcactgcgtcagagtgg
gagagagccgtagagggtctcaaaccaacaaccaaaggttctgacccagaaataacccgt
gtcactcgtcactcacaacccattggccagagctagtcacatgcacggccctgccccaag
GAAGGCAGTCGGGTCGGGCAGTCCTACCAGGTGCCTGGTACAGGGGAGAATGTAAACACT
TGGTAAATGGCAGCACTGACTACTGCATGAAGGAATCAAAGCTGGGAGGGATTAAGTACT
TGCCTAACATCACATCGGCC
gtaagtgacagaatcaggatttgaatccacccaggcgtgatttcaaagtcgatgtccttt
ctgcttctttctacgctgcctgctcttctcttaaaggaagcttatagtaaaaattctttt
acatcaatgatgcaatgccctcttccttaatcatctgatagtttaattgaatagacacga

 9.07 Intr +  88198  88288   91  0  1   19   86   121 0.029   3.65
agaactgcttgaacaatttaaatcataagaatgcaagcctttcacaatatttaattttaa
aattttataattgtggtttcagaatgataatattacagtaataataaatacatagttacg
ctggaaaatatgaaataaagattcccatgtaagacatcgagaagattgtctttttcaaag
AGAAAGGAAATGGGAAAACACAGTGGTAAAGCCGGGGCCACCACAGGTTGTGTCCGGCTT
GAAGCTAAACTGCCGGCAAGGCCAGAGCAAG
gtatggattaaagctaagtgtctgtgagcccagggctgattcagcagtggagcttcctct
gcagaagacatccacaacccaggatcagcaaggaagggatggcacaaactcaacaaatcc
aataattggcactgagggaacagaaagaatggaagaggctgaaacagacattaagataat

 9.08 Intr +  94182  94371  190  1  1   88   98    99 0.779   8.62
ctaccctgattgtgccacctgtgagataaggctcttgtatctggacaggcagaggagttt
gttttctggggcttatgtggcgggttggcactttgctagccctaccatggagttagctca
cgacgtggtacgtggtaagtggaccattgatgtgtctcaaacttgtctttttgttctcag
TTGCAGAATGCCATGACCATGGTAGCACTTTTCAAGGAAGAAAGAAAGGTGGGAGTTCTT
TCCGGGATAATTTTGACAAGAGGAGCTGTCATTATGAACATGGTGGGTATGAGCGCCCGC
CTTCACACTGCCAGGAGAATGATGGAAGCGTGGAGATGAGGGATGTCCACAAGGACCAAC
AACTAAGACA
gtaagtgaccaggcagcctggtttgcacgtagcagcccccgggactgtgcaaccctttca
ttctctgtggtcttccttttcttctctcattagagaactgacgaatgctggaagtggaat
agtggctgagcaatcctaattgtagccctggcgtcagtgagtggagcatgtataggagac

 9.09 Intr +  94598  94748  151  2  1  119   79   111 0.909  12.54
gtgcaaccctttcattctctgtggtcttccttttcttctctcattagagaactgacgaat
gctggaagtggaatagtggctgagcaatcctaattgtagccctggcgtcagtgagtggag
catgtataggagactttcttagatttaatggatacccgccttctctcctcttccccacag
CACTCCTTATAGCATCCGATGCGAAAGAAGAATGAAATGGCATAGTGAAGACGAAATCCG
TATTACCACGTGGAGAAATAGAAAACCTCCGGAGAGAAAAATGAGTCAGAACACACAGGA
TGGATACACAAGGAACTGGTTTAAGGTCACA
gtgagtatcttggtggggtctgcattaggtggactattctggaacctgatagaaggaaga
ccacttaaaacaccctaagttgattatttggaggagagcttcggaatggggggaaaggga
gtttagggcatctatatttggcacaaaaataagaaatcatgtcagcggtcctttctttag

 9.10 Intr +  95052  95135   84  2  0  104   58    33 0.664   1.00
tagggcatctatatttggcacaaaaataagaaatcatgtcagcggtcctttctttagaaa
tctaagctaagtagaaggttggaaagaaagaaaaaaaaaacccagctggttggttctgtt
ctccatccttagttccacgttgtctctcccttccctcctatttcttctttttacccttag
ATTCCTTACGGGATAAAGTATGACAAGGCATGGCTAATGAATTCAATCCAGAGCCATTGC
AGTGACCGCTTCACTCCGGTTGAT
gtaagagaggatggtgaagccagatgagtgggcatgggggacggggagaggcctggctca
gcaggggccattggcctctgacgctgttgctcttgccttcactccctgtagttccactac
gtccgaaatcgggcatgcttctttgtccaggatgctagcgctgcctccgcattgaaggat

 9.11 Intr +  95247  95351  105  2  0   98   93   117 0.999  12.69
aagtatgacaaggcatggctaatgaattcaatccagagccattgcagtgaccgcttcact
ccggttgatgtaagagaggatggtgaagccagatgagtgggcatgggggacggggagagg
cctggctcagcaggggccattggcctctgacgctgttgctcttgccttcactccctgtag
TTCCACTACGTCCGAAATCGGGCATGCTTCTTTGTCCAGGATGCTAGCGCTGCCTCCGCA
TTGAAGGATGTCAGTTATAAGATTTATGATGATGAGAACCAAAAG
gtgtgtgccgagggcatgccctgtacttagtctctgggcaggaggacaggccagggggct
ggtcatcctctttgggattagaggtcctggtacttaccaccctgccttcctgcagatatg
tatatttgtcaatcattctactgcgccctactctgtgaagaataagttgaagccaggcca

 9.12 Intr +  95694  95763   70  2  1  103  110    65 0.983   8.04
taagttgaagccaggccaaatggagatgctaaaggtaatacagactcaaggatcattgta
tgtccacttcctggacccacctcttcttcccctggccccctctttccctgtcaccacacc
accaccaccaccaccatcaccagagccccagagcctctgtcttcatctctatctctgcag
CTGACCATGAACAAACGGTACAATGTCTCCCAGCAAGCTCTTGATCTCCAGAATCTCCGC
TTTGACCCAG
gtaaggctgacagcagcaattctaagacaagcgggggcagagaggtctgcctgggaggga
gacttaggaatggcaatttacagaggggttggggctggctctggtccagccagggccctc
ccagccttccgattcccttctcttggcttcttcaagacttgatgggccgtgacattgata

 9.13 Intr +  95920  96008   89  2  2   66   57    87 0.921   2.17
tccagaatctccgctttgacccaggtaaggctgacagcagcaattctaagacaagcgggg
gcagagaggtctgcctgggagggagacttaggaatggcaatttacagaggggttggggct
ggctctggtccagccagggccctcccagccttccgattcccttctcttggcttcttcaag
ACTTGATGGGCCGTGACATTGATATAATCCTGAATCGAAGAAACTGCATGGCTGCCACCC
TGAAGATCATTGAAAGAAATTTCCCTGAG
gtgaagccttaggctcagtgctggtatttagttagaggggtggaagggataaggtggagg
gcagatttgtctctgaggcccaagatagtagccgccactctaactcttcttgacccaaag
ctgttgtctttgaacttgtgcaacaacaagctgtaccagctggatggcctttctgacatt

 9.14 Intr +  96129  96236  108  2  0   25  100    95 0.853   3.96
ctgaatcgaagaaactgcatggctgccaccctgaagatcattgaaagaaatttccctgag
gtgaagccttaggctcagtgctggtatttagttagaggggtggaagggataaggtggagg
gcagatttgtctctgaggcccaagatagtagccgccactctaactcttcttgacccaaag
CTGTTGTCTTTGAACTTGTGCAACAACAAGCTGTACCAGCTGGATGGCCTTTCTGACATT
ACAGAGAAGGCTCCCAAAGTCAAGACCCTGAATCTCTCCAAAAATAAG
gtgagaagggggagccagatcaactttgggtggagggcaggacacatcaggataatggca
acagccaggcagtggcacctgtgggtgactatgagggccgggggaattcagggcccaggg
tcctgggtgtctctctttccctggccctccttctccagtttcctccccatctttcttagc

 9.15 Intr +  96416  96525  110  1  2   91   86    99 0.545   8.16
ggtgagaagggggagccagatcaactttgggtggagggcaggacacatcaggataatggc
aacagccaggcagtggcacctgtgggtgactatgagggccgggggaattcagggcccagg
gtcctgggtgtctctctttccctggccctccttctccagtttcctccccatctttcttag
CTGGAGTCGGCGTGGGAGTTGGGCAAGGTGAAAGGGCTGAAGCTCGAAGAGCTATGGCTA
GAAGGGAACCCGTTGTGCAGCACCTTCTCGGACCAGTCCGCCTATGTAAG
gtcagtggcaaccccggtcacccttcctgggcacctttgctccctgggtgactgagctgt
gtctgaaggtgcccttctgcaggaagaagcagccttggtcctctgggaggaccacagacc
tcccttcctactctctctctctctctctctctcctctctctctgtcactcactcatctgt

 9.16 Intr +  96788  96998  211  2  1   32   25   153 0.166   1.39
gaagaagcagccttggtcctctgggaggaccacagacctcccttcctactctctctctct
ctctctctctcctctctctctgtcactcactcatctgtgcttagaggtctcctttccttc
ctctgacatggtccccttttcacctgctctggggtgtgtttcccgcctgtctccaccaag
CCTCCTCCAGTGTGCCCTCTGTGAGTGTGCTCCAGGAAGTGGGGCTCCCCCACCTCCCCA
GGACCAGCAGTATTCAGATGCTGGTGCCCTGGACCGAGAAGAGTCCTTTAGTCCGGGGCT
TCATGCTGAGACAGGCCTTCCTGCCTCCATGCTGCGATGGGGCTTCCCTCCCCTGTCCCA
AGAGGGGTTCTCCTTCTCTTGCTCCAAAAAG
gtccccccacctgtcctgggctggcatgggggcttccctgccccatactgagggctgggg
ccccgggtggctgctgtcatgccatctcttcctctggcccaatgccaggagctgggccct
ccttggggagaaacctgggtttcctacgtcaaggggccagaagcgggccacgttcctgag

 9.17 Intr +  98618  98721  104  1  2  146   59    71 0.983   8.05
cacacatttgcatgtgatagtagagatgtccagcaccccatgagaaagccacccactgga
atttccagggccatttcccacctagcctctgatgcttgtctccctgggcatgttcatctt
atcgatcatccagctccatctccttggtctccactgctgacttcctctttccttctccag
GACGGCCGAGAGTTATCCGCACCAGTGATTGTTGACATTGACAGCTCTGAGACAATGAAA
CCCTGCAAGGTGAGGAAGAAGGACCAAGCAAGATTTGGGTTGCT
gtaagggaggctttgtccaccgcatagatccaaattgtcttttgatttcaggaaaacttt
actggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtgagtatccctg
ggaccatgaggaaggggagggctgagacaggctgggccacccgtgcagcctgggagtttt

 9.18 Intr +  98960  99067  108  2  0   94   86   113 0.999  10.18
ttactggatctgagaccctaaagcatttagtcctgcaattcctgcagcagtgagtatccc
tgggaccatgaggaaggggagggctgagacaggctgggccacccgtgcagcctgggagtt
ttcaagtctcatctggggcccaggccacagagatagcctatcctcactgcttccccacag
GTATTACTCGATCTATGACTCTGGAGATCGACAGGGTCTCCTCGGTGCTTACCACGATGA
GGCCTGCTTCTCCTTGGCTATTCCCTTCGACCCCAAGGACTCAGCCCC
gtgagtatcacggctcagaccctgctctggggctgtgtgtctccccagcagacacaggcc
aactcctggaaatgcccacactggccggaccacccactcctgctcctctttttctcctag
gagcagcttgtgcaagtactttgaggatagcaggaatatgaaaacactcaaggacccctg

 9.19 Intr +  99188  99276   89  2  2  125  116    10 0.600   6.20
ttaccacgatgaggcctgcttctccttggctattcccttcgaccccaaggactcagcccc
gtgagtatcacggctcagaccctgctctggggctgtgtgtctccccagcagacacaggcc
aactcctggaaatgcccacactggccggaccacccactcctgctcctctttttctcctag
GAGCAGCTTGTGCAAGTACTTTGAGGATAGCAGGAATATGAAAACACTCAAGGACCCCTG
TAAGTGTGTGATGGGGAAGAGTGGGCAAG
gtaagggggtgtgatgggaacaatcacaggggccaaggaccaggatgtggtagccccccg
ccctgccccgcccaccctgccattccttgcttctcctctcctctacagacctgaaggggg
aactgctgaggcgcacaaaacgtgacattgtggactccctcagtgcgttgcccaaaactc

 9.20 Intr +  99385  99500  116  2  2  121  101    94 0.671  13.25
actttgaggatagcaggaatatgaaaacactcaaggacccctgtaagtgtgtgatgggga
agagtgggcaaggtaagggggtgtgatgggaacaatcacaggggccaaggaccaggatgt
ggtagccccccgccctgccccgcccaccctgccattccttgcttctcctctcctctacag
ACCTGAAGGGGGAACTGCTGAGGCGCACAAAACGTGACATTGTGGACTCCCTCAGTGCGT
TGCCCAAAACTCAGCATGACCTCAGCTCCATCCTGGTGGACGTGTGGTGCCAGACG
gtgagcacctgcttcctcccttgggcaggcccagagagccagaggtgggtaggaggttaa
ggaggatcctgagcacctgagcgcttccttttcaggaaaggatgctctgcttttctgtca
atggggttttcaaggaaggtgagtgtctgtatagtcccctccccagatcccccactgctc

 9.21 Intr + 100214 100311   98  1  2    1   92   144 0.333   3.99
gggccctgtcactgggagcggattgttcctgttgctgccctccccattcctgccacatcc
gcctgactccaagtgaacaattgtcctggtctgccccctcccccccttctgtgtgagtgt
caagcaatactctgactggggatcaccgtgtgagcatgttaaagcctgtgcaactctaag
GTGGTGGTGTTTGTTGTCTTTGAAGTGGAAGGACAGTCTCAGGGTTCTGTTCTCGCCTTC
ACCCGGACCTTCATTGCTACCCCTGGCAGCAGTTCCAG
gttagtgctgtgttgtgggtgggagcacccatccaagcttggggccagtgttgtggaaat
gtggtgggtgcagtcctccgggtgttctcaatattgtggaaggccgacaggaagatccaa
ggagcagtctagcctagtgtttaagagtgtgggccctggagtcagaatacagattctgtt

 9.22 Intr + 100846 101028  183  1  0   64   81   164 0.988  11.28
ccaaaggtggactctgtgggagggttagagggtaccagccaaaaaatctgggaggcaggc
acagttagggatatggaaggaatttggttgttgagtggcagtggttaagaaggatcctgt
tgttgggggtgcggagttatctacttgtccagtttgagggtgcatttttctttcctccag
TCTGTGCATCGTGAATGACGAGCTGTTTGTGAGGGATGCCAGCCCCCAAGAGACTCAGAG
TGCCTTCTCCATCCCAGTGTCCACACTCTCCTCCAGCTCTGAGCCCTCCCTCTCCCAGGA
GCAGCAGGAAATGGTGCAGGCTTTCTCTGCCCAGTCTGGGATGAAACTGGAGTGGTCTCA
GAA
gtgagtgctgggagtacatggggatgggggctgttgggacatcagaggaatgagtaatgg
aaactcacatgcaatttggaaaaataactatctgggtattttgcttccaaaaaaagtggg
tccatgaaaaaggtatcatacttttatactggtatatgtaaatatttttttaaatggcat

 9.23 Intr + 102149 102466  318  2  0  -11   89   219 0.832   6.25
atcacgtgcaaacactggcagaaaatggatcaatgacctaaaataagagccagaactgta
aaacactgtaagtgtacatcttcattaccttgaattaggcaaccatttcttacatatgaa
accaaaagcacaagcaaccaaagaaaaaataggtaaattggacttcatctaaattaaaag
CTTTTGTGCATCAGCAGACACTATCAAGAAAGCGGAAAACCGACTGGTGGGAACAAGGGA
AAATATTTGCAAATCACATCGCCGACAAGAAGAACCCTTACAACTCAACAACAAACAGAC
AAGCCACCGAATTAAAAAATGGGGAAATGATTTGAATAGATGTTTCTCCAAAGGAGATAT
ACAAATGACCAAGAAGCACGTGAAAATCTTCTCAACATCGTTAGTCATTAGGGAAACGCA
TATCGAAACCACAGTGAGTTACCACTTCATACCCACTACGCTAGCTTTAGTCCATAAAAG
GAAACATGACAAATGTCG
gtgagaatgcagagaaattggaaatctcatgtattactactgggaacataaagtggagca
gttgctggcaaaaagattttggcagttcctcaaaatcttaaacatggagttaccacatga
tccagtaatcccactcctaagtgtataccaaaagaaatgaaaatatatgcccattcaaca

 9.24 Intr + 103439 103574  136  2  1   90   72    93 0.864   7.55
gcattaatgtcagggatgggcgttttggttttccccaggccttttttcattgttacaata
gtgctcatattggtacatgtgacccagcaaaaaggtagcatagattaagggtggcattgc
atagtcagcgtgtctgtcctgggctagtaatggagagcacctgttcttctcccaccccag
GTGCCTTCAGGACAATGAGTGGAACTACACTAGAGCTGGCCAGGCCTTCACTATGCTCCA
GGTGAGGTCTGGGAATCAAGTGGGTAAAAGACAGCTGTCTCTGGGTCGTCAGGAGGGCCA
AGAAGATGGAGGCCAG
gtagtgtggggatggaacccagtgcacctggctctactaacatcccaactccttttcttt
actttctctagaccgagggcaagatccccgcagaggccttcaagcaaatctcctaaaagg
agccctccgatgtcttctttgtcttcgttcacatcctctttgtttcctcttttcaccagc

Predicted peptide sequence(s):


>NXF2_1|GENSCAN_predicted_peptide_1|337_aa
XGILRVLGLMKMDMVNYTIQSFRPYLQEHSIQYEQAKFQELLDKQPSLLDYTTKWLTKAA
TDITTLCPSSPDSPSSSCSMACSLPSGAGNNSEPPSPTMVLYQGYLNLLLWDLENVEFPE
TLLMDRIRLQELAFQLHQLTVLASVLLVARSFSGEVLFRSPEFVDRLKCTTKALTEEFIS
RPEETMLSVSEQVSQEVHQGLKDMGLTTLSSENTASLLGQLQNITKKENCIRSIVGKNLH
GRRAEKWQECGAWVGRPYPEYQWIRFFLKCCLLHGMQESLLHFPGGLILIEKELAELGWK
FLNLMHHNQQVFGPYYAEILKHIIHPAQAQETDVEPN

>NXF2_1|GENSCAN_predicted_peptide_2|892_aa
MDKFLDTYTLPRLNREEVESLNRPITGSEIEAVINSLPTKKSPGPDGFTAEFYQSSFYED
SIILIPKPGRDTAKKESFRPISLMNIDAKILNKILANRIQQHIKKLIHHDQVGFIPGMQG
WFNIHKSINVIQHINRAKDKNPMIISIDAEKAFDKIQQPFKLKTLNKLGIDGTYLKIIRA
IYDKPTANIILNGQKLEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKGIKGIQLGK
EEVKLSLFADDMIVYLENPIVSAQNLLKLRSNFSKVSGYKINVQISQAFLYTNNRQTESQ
IMSELPFTIASKRIKYLGIQLTRDVKDLFKENYKLLLNEIKEDTNKWKNIPCSWVGRINI
VKMAILPKVIYRFNAIPIKLPMTFFTELEKTTLKFTWNQKRARIATSVLSQKNKAGGITL
PDFKLYYKATVTKTAWYRYQKRDIDEWNQTEPSEIMPHIYNHLMFDKPDKNKKWGKDSLF
NKWCWENWLALCRKLKLDPFLTPYTKINSRWIKDLNVRPKTIKTLEENLGITIQDIGMGK
DFMSKTPKAMATKAKIDKWDLIKLKSFCTAKETTIRVNRQPTKWEKIFATYSSDKGLISR
IYNELKQIYKKKTNDPIKKWAKDMNRHFSKEDIYAAKKHVKKCSSSLAIREMQIKTTMRY
HLTPVRMAIIKKSGNNRCWRGCGEIGTLLHCWWDCKLVQPLWKSVWRFLRDLELEILFDS
AIPLLGIYPKDYKSCCYKDTCTRMFIAALFTIAKTWNQPKRPTMIDWIKKMWHIYTIEYY
AVIKKDEFMSFVGTWMKSEIIILSKLSQEQKTKHRIFSLIEGRRGTFHIEGGNVMTDTRS
YDAGFDDKGMGALEAPGKNPLPCQGIKNTASEAKNGKAMDSPLELPEGAWPY

>NXF2_1|GENSCAN_predicted_peptide_3|218_aa
MGDFNTPLSTLDRSTRQKVHKDIQELNSALHQVDLTDIYRTLHPKSTEYTFFSAPHHTYS
KIDHTVGSKALLSKRKGTEILTNCLSDHSAIKLELRIKKLTQNRSTTWKLNNLLLNDYWV
HNEMKAEIEMFFETNENKDTTYQNLWDTFKAVCRGEFIALNAHKRKQERSKIDTLTSQLK
ELEKQEQTHSKASRRQEITKIRAELKEIETQKNPSKNQ

>NXF2_1|GENSCAN_predicted_peptide_4|158_aa
MAAPSGTGLMGTLSGSSAPVAGLYMGPQAVCNILRNLGGGRHRPIARECCAPAESAPFGC
RQDGPSTSEHPEYNSKPAKKALKRGKGKADRLMLSGLEQEHRQRIPLVFLFPPNIPDRAP
QKPPVQNHQQWQTQSSKKSLFPLPKDHKKRDLKTEKPL

>NXF2_1|GENSCAN_predicted_peptide_5|183_aa
MVRIWPSRCLHVGPLSVRESHYEILGATIDGPADPPCPELFPSVTLCTLETYTGTAGCFK
LAKLESVVPHAEEKDRIRKVSCAQSVSQSETGVRKIGYVTDLHKRKTLRRKQQTLRSLVG
LLPIVLYVLLLVTDHSVGYVTWADPVVAHHFPVHTDRFTYGYLTQVRTVETFPGCFSGVG
AGY

>NXF2_1|GENSCAN_predicted_peptide_6|446_aa
MTGSDSHITILTLNVNGLKAPIKRHRLANWVKSQDPSVCCIQETRLTCRDTHRLKIKGWR
KIYQANGKQKKAGVAILVSDKTDFKPTKIKRDKEGPYIMVKGSIQQEELTILNIYAPNAG
APRFIKQVLRDLQRDLDSHRIIMGDFNTPLSTLDRSMRQKVHKDIQELNSALHQVDLIDM
YRTLHPKSTEYTFFSAPHHTYSKIDHIVGSKALLSKCKRTEILTNCLSDHSAIKLELRIK
KLTQNRSTTWKLNNLLLNDYWVHKEMKAEIKMFFETNENKDTTYQNLWDTFKAVRRGKFI
ALNAHKRKQERSKIDTLTSQLRELEKQEQSHSKASRRQEITKIRAELKGIETQKTLQKIN
ESRSWFFEKINKIDRPLARLIKKKREKNQIDAIKNDKGDITTDPTEIQTTIREYYKHLYA
NKLVNLEEMDKFLDTYTRPRLNLGRS

>NXF2_1|GENSCAN_predicted_peptide_7|477_aa
MIISIDAEKAFDKIQQPFKLKTLHKLGIDGTYFKIIRAIYDKPTANIILNGQKLEAFPLK
TGTRQGCPLSPLLFNIVLEVLARAIRQEKEITCIQLGKEEVKLSLFADDMIVYLENPIVS
APDLLKLISNCSKVSGYKINVQKSQAFLYPNNRQTESQIMSELPLTVASKRIKYLGIQFT
RNVKDLFKENYKPLLNEIKEDTNKWKNIPCSWVGRINIVKMTILPKVIYRFNAIPIKLPM
IFFTELEKTTVKFIWNQKRARIAKSILSQKNKAGGITLPDFKLYYKATVTKTAWYRYQNR
DIDQRNRTEPSDIMPHIYNYLIFDKPEKNKKWGKDSLFWKWCWENWLAVCRKLKLDPFLT
PYTKINSRWIEDLNVRPKTIETLEENLGNTIQDIGMGKDFMSKTPKAMATKAKIDKWDLI
KLKSFCTAKETTVRVNRQPTEWEENFAIYSSDKGLISRIYNELQQIYKKKTNHPLNK

>NXF2_1|GENSCAN_predicted_peptide_8|246_aa
MASAATWMELKATTTFEIAGRIAGRAGRDRNLACMESRGFSMGKAALKHGHGHPTPSLTT
LLSVALVFAGCWTWTQQGNLGHGIGRCLAVGDLLQVVPCRQVHPPAALLHRCTLTHSLPA
LLRWDRRRKKKKKKKKKKKKKKKKKKKKEEEEEEEEEEEEEEEEEERRSSHHRRCCHHLH
WPLPIMMDLRPQATDQFTECGPLEKQGGSPEPRCSPRKLVAEGCLWTALPAERGKHPKGE
SESVLK

>NXF2_1|GENSCAN_predicted_peptide_9|1025_aa
MSLRIQSSESHRDKWLHREKRFEGNETVQEEQELMPIHLMRGILEKNEDVKKTGVHIEPG
VEILAVQGGGKCRADCHSYDAFLESSGKATPPKATSMDPQNVHHRTKRLSAPNPVREVLP
APHPDSGGSFIGLRLRSEAFRQLSYPDALEGSLVRVEPAAFPSSFCETVVSGQSNNKMCS
TLKKCGTYRTEGRQSGRAVLPGAWYRGECKHLVNGSTDYCMKESKLGGIKYLPNITSARK
EMGKHSGKAGATTGCVRLEAKLPARPEQVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHY
EHGGYERPPSHCQENDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRK
PPERKMSQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACF
FVQDASAASALKDVSYKIYDDENQKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILN
RRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
LGKVKGLKLEELWLEGNPLCSTFSDQSAYVSLLQCALCECAPGSGAPPPPQDQQYSDAGA
LDREESFSPGLHAETGLPASMLRWGFPPLSQEGFSFSCSKKDGRELSAPVIVDIDSSETM
KPCKVRKKDQARFGLLYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFE
DSRNMKTLKDPCKCVMGKSGQDLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQT
VVVFVVFEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELFVRDASPQETQSAFSIPVS
TLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQNFCASADTIKKAENRLVGTRENICKSH
RRQEEPLQLNNKQTSHRIKKWGNDLNRCFSKGDIQMTKKHVKIFSTSLVIRETHIETTVS
YHFIPTTLALVHKRKHDKCRCLQDNEWNYTRAGQAFTMLQVRSGNQVGKRQLSLGRQEGQ
EDGGQ