GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:57:03

Sequence MAGEH1_1 : 3860 bp : 46.63% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1471   2130  660  0  0   90   42   663 0.877  58.08
agctggcgtgggaactaccctttgtagctgagaacggcttgtttattgctacaaagactc
tattgacattggtagcttcagcggcagcagcttcttacggtataaagctgttgcttcctg
aagaggctacaagcatccttccctaggactgctgtaagctttgagcctctagcaggagac
ATGCCTCGGGGACGAAAGAGTCGGCGCCGCCGTAATGCGAGAGCCGCAGAAGAGAACCGC
AACAATCGCAAAATCCAGGCCTCAGAGGCCTCCGAGACCCCTATGGCCGCCTCTGTGGTA
GCGAGCACCCCCGAAGACGACCTGAGCGGCCCCGAGGAAGACCCGAGCACTCCAGAGGAG
GCCTCTACCACCCCTGAAGAAGCCTCGAGCACTGCCCAAGCACAAAAGCCTTCAGTGCCC
CGGAGCAATTTTCAGGGCACCAAGAAAAGTCTCCTGATGTCTATATTAGCGCTCATCTTC
ATCATGGGCAACAGCGCCAAGGAAGCTCTGGTCTGGAAAGTGCTGGGGAAGTTAGGAATG
CAGCCTGGACGTCAGCACAGCATCTTTGGAGATCCGAAGAAGATCGTCACAGAAGAGTTT
GTGCGCAGAGGGTACCTGATTTATAAACCGGTGCCCCGTAGCAGTCCGGTGGAGTATGAG
TTCTTCTGGGGGCCCCGAGCACACGTGGAATCGAGCAAACTGAAAGTCATGCATTTTGTG
GCAAGGGTTCGTAACCGATGCTCTAAAGACTGGCCTTGTAATTATGACTGGGATTCGGAC
GATGATGCAGAGGTTGAGGCTATCCTCAATTCAGGTGCTAGGGGTTATTCCGCCCCTTAA

gtagatctgaggcagacccttgggggtgtaaaagagagtcacaggtaccccaaggagtag
atgccagggtcctaagttgaaaatgatgtcgattgggggcgggggacactgtatttgata
tttgtgatcagtgatcattgttcaactgcgaaatagagtgtttgcttttgataatggaaa

Predicted peptide sequence(s):


>MAGEH1_1|GENSCAN_predicted_peptide_1|219_aa
MPRGRKSRRRRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEE
ASTTPEEASSTAQAQKPSVPRSNFQGTKKSLLMSILALIFIMGNSAKEALVWKVLGKLGM
QPGRQHSIFGDPKKIVTEEFVRRGYLIYKPVPRSSPVEYEFFWGPRAHVESSKLKVMHFV
ARVRNRCSKDWPCNYDWDSDDDAEVEAILNSGARGYSAP