GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:56:22

Sequence MAGED2_1 : 10674 bp : 50.02% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2795   2839   45  1  0   62  110    34 0.940   3.68
tttgaattcctgtatctgagaacggagtcgttgggggtggtggagggggttggaattggg
gacctacggaaggtgaggatcagcctccaggcacaacaggggagaggacgttcagtgggc
ttcaacttgacccaggccttctccccttcaggctcagctcttgccaggccaaattgagac
ATGTCTGACACAAGCGAGAGTGGTGCAGGTCTAACTCGCTTCCAG
gtaaggcctctttctgtcctttccccagctgcttttcctctccagcccttgttgctgccc
ccaagtcccttggctcttcccctcccatccttgtccttctccacctactttcctgcctgg
gtgtccccctgcccagtggagggagggagagaaggtgggcgggcccctcttctgccatca

 1.02 Intr +   3185   3676  492  1  0  109  116   323 0.850  30.40
cctcttctgccatcagttcttgctcagaggaaagggaggccttgttgggctgaggtggtc
agagcacaccgcaggtaggagtcagtacaggtcagagaagtgtggccttggaattttgga
gccatttgcttagttgggggtgaggagaaggtctatgaacttccctgcttcctcttgcag
GCTGAAGCTTCAGAAAAGGACAGTAGCTCGATGATGCAGACTCTGTTGACAGTGACCCAG
AATGTGGAGGTCCCAGAGACACCGAAGGCCTCAAAGGCACTGGAGGTCTCAGAGGATGTG
AAGGTCTCAAAAGCCTCTGGGGTCTCAAAGGCCACAGAGGTCTCAAAGACCCCAGAGGCT
CGGGAGGCACCTGCCACCCAGGCCTCATCTACTACTCAGCTGACTGATACCCAGGTTCTG
GCAGCTGAAAACAAGAGTCTAGCAGCTGACACCAAGAAACAGAATGCTGACCCGCAGGCT
GTGACAATGCCTGCCACTGAGACCAAAAAGGTCAGCCATGTGGCTGATACAAAGGTCAAT
ACAAAGGCTCAGGAGACTGAGGCTGCACCCTCTCAGGCCCCAGCAGATGAACCTGAGCCT
GAGAGTGCAGCTGCCCAGTCTCAGGAGAATCAGGATACTCGGCCCAAGGTCAAAGCCAAG
AAAGCCCGAAAG
gtaagacctctgcagtcaccacccttggttttctactcctctctcagttgattcatttgt
tctacaaacatttagaaagatccctgtgctcatcagggctgtggggggcactgagagtaa
tgtgatgtaattcctgtcttcagagagcttgcagactgatggggaggtgcaatctgaatg

 1.03 Intr +   4284   4592  309  2  0   90   90   123 0.997   9.21
atgaaacacctgcttggaagtcagtgagaaacaaatccagggttcagcatggccaacatc
tattgagtcaggctgttactacaggggtgggattagcgggtgcttcctggaagagatagg
gagaggaaaaggaccacttgcttcatctggtgacgttgagcttcctctctgttgatgcag
GTGAAGCATCTGGATGGGGAAGAGGATGGCAGCAGTGATCAGAGTCAGGCTTCTGGAACC
ACAGGTGGCCGAAGGGTCTCAAAGGCCCTAATGGCCTCAATGGCCCGCAGGGCTTCAAGG
GGTCCCATAGCCTTTTGGGCCCGCAGGGCATCAAGGACTCGGTTGGCTGCTTGGGCCCGG
AGAGCCTTGCTCTCCCTGAGATCACCTAAAGCCCGTAGGGGCAAGGCTCGCCGTAGAGCT
GCCAAGCTCCAGTCATCCCAAGAGCCTGAAGCACCACCACCTCGGGATGTGGCCCTTTTG
CAAGGGAGG
gtaagaactctgtcgtttttattctgccttttctactgccttggctgtccttttctttgc
catcgtctcaagttttctgcaaacttgttttggtctttccatctttttctactctgccag
gcaaatgatttggtgaagtaccttttggctaaagaccagacgaagattcccatcaagcgc

 1.04 Intr +   4713   4776   64  2  1   65   70    87 0.998   2.89
cagtcatcccaagagcctgaagcaccaccacctcgggatgtggcccttttgcaagggagg
gtaagaactctgtcgtttttattctgccttttctactgccttggctgtccttttctttgc
catcgtctcaagttttctgcaaacttgttttggtctttccatctttttctactctgccag
GCAAATGATTTGGTGAAGTACCTTTTGGCTAAAGACCAGACGAAGATTCCCATCAAGCGC
TCGG
gtaaagtcctaccaatcctccctctgccctgagctctgccctccattgcccttacaccat
tgtgctggggatatcccctgctcttatgcttatgtctctgtcctcccaaagttctgattt
ggcagtgctagcatctctgttgataagcacagaaccgggttatgccacccttggtgtggt

 1.05 Intr +   5037   5116   80  1  2   91   67   154 0.952  12.87
ctcttatgcttatgtctctgtcctcccaaagttctgatttggcagtgctagcatctctgt
tgataagcacagaaccgggttatgccacccttggtgtggttggcaaagagtctatagctt
gggcatcagggccacctggcatctcttcagtcaggtgctcacaacactctccccttgcag
ACATGCTGAAGGACATCATCAAAGAATACACTGATGTGTACCCCGAAATCATTGAACGAG
CAGGCTATTCCTTGGAGAAG
gtgaaggggcagccctgggggatgggcacagtggggaagccttgaattgaacaaaaatgt
acaagtcccttctcgggaaccaaagagacctgctaatccagctccatcgctatgctgagg
ggcagacagtggcctagggaggggtgtagattagcgatgggtcacacagcaagtcaatgg

 1.06 Intr +   5620   5714   95  0  2  112   85    65 0.999   7.36
tgatgatgacaatagtacatttgcagcgtgtttaccgggtgccaggcacttagctatgta
ctttgtgcgtattatctcactgatttctcacacatgcgaaactcctaggtacatagggag
ctgcagcatgccccggaagctgaattttgtcatctcacaagctgttctccccatccacag
GTATTTGGGATTCAATTGAAGGAAATTGATAAGAATGACCACTTGTACATTCTTCTCAGC
ACCTTAGAGCCCACTGATGCAGGCATACTGGGAAC
gtaagctgggaaagggctgaggtgtggggggcttctgctttggccatgtgctgctactcc
tcctttgtcctacttcccccatcctcttagagagtcaggaaagacagggtctcaaaagcc
ccgtcccagttcctatgcatagttggagccctgcttacagtggtggcacctgattatgat

 1.07 Intr +   6408   6487   80  0  2  123   96    86 0.974  12.09
agagtagactgaggcttgcaagtctaagtgccttgccaagggtggcatagagctggaagc
agagactgggtagaattctgtatctgaggaatctgggagaggctagcctagtgagttggc
tggtgtgtctgttgcagatggctgctgaacataaacctctctgtcctgttatttctctag
GACTAAGGACTCACCCAAGCTGGGTCTGCTCATGGTGCTTCTTAGCATCATCTTCATGAA
TGGAAATCGGTCCAGTGAGG
gtgagtggctgggcttgcagctgaatgggtggctgtggtctagattccatgtgttcaatt
tctgtccctgtctcctcttgcctcccctcgcagctgtcatctgggaggtgctgcgcaagt
tggggctgcgccctgggtatgattgggctctctcagcgcttgctgtccgtgttgtccttt

 1.08 Intr +   6581   6623   43  0  1  117   51    40 0.551   0.50
tctctaggactaaggactcacccaagctgggtctgctcatggtgcttcttagcatcatct
tcatgaatggaaatcggtccagtgagggtgagtggctgggcttgcagctgaatgggtggc
tgtggtctagattccatgtgttcaatttctgtccctgtctcctcttgcctcccctcgcag
CTGTCATCTGGGAGGTGCTGCGCAAGTTGGGGCTGCGCCCTGG
gtatgattgggctctctcagcgcttgctgtccgtgttgtcctttggcaagagaggacggt
cctaggattgcatcagtctggtggtctggtggagcgggtggggtgctggactgggtagag
ggcccagggttctgacctgggtggatgatgggtgaatggtcctgaactctctgctccctc

 1.09 Intr +   6951   7013   63  0  0  116  100   120 0.999  13.83
atgggtgaatggtcctgaactctctgctccctctctcagtgtctcttgggcttctatgga
gcttccctcttgtgctggaaacctcttttccatcttggaaatgcctctgcccacatctgg
gaagtgccatagccttgagtgaatttatttgtttatttatttttctttttcttctctcag
GATACATCATTCACTCTTTGGGGACGTGAAGAAGCTCATCACTGATGAGTTTGTGAAGCA
GAA
gtaagtatctctgtctggtgttcatgtgtcccatgcatttggcctatttcagaactgagt
gataaagccgtggtgcatggatgcatgtgtctatgtgtgtatgtatttgcatatttgcat
gtatgcaggtgggattattccttgggcggtgatgggaaacaggagcagcacatgtttcct

 1.10 Intr +   8124   8238  115  0  1   43   86   154 0.988  11.15
acaaacgtcccccaacacctctatgtggcttctgggcaagaccagtgggacagggctcaa
tattggaagaaagactgtagtaattagtggatgatgttgccatctggagcctgtccagtc
tatgcatgggtaggccatgaatggtcttagaaataaaggctttgaacctctctttccaag
GTACCTGGACTATGCCAGAGTCCCCAATAGCAATCCCCCTGAATATGAGTTCTTCTGGGG
CCTGCGCTCTTACTATGAGACCAGCAAGATGAAAGTCCTCAAGTTTGCCTGCAAG
gtaattggagagctccttgagcttggcaagtcaagagcatggggtgcccctggctggggc
aggctgtgtgcagagcagcctgcagttcaaatctgaatgttttggtgcttctgttaattg
tcaaaacactgtaacaggcactttatctgaatcatttaagccttacaacctgatatgtca

 1.11 Term +   8711   9145  435  1  0  107   50   487 0.998  42.09
actggtaatactgtattattactattatctttttatactaagcatgtagcatagtgccta
gcataaaggtagatgcttaatcctcttatgctccttctgatggttatttacatagtaata
ctgtattattactatggcttaatccctctatgctccttctgatggttatttttgtttcag
GTACAAAAGAAGGATCCCAAGGAATGGGCAGCTCAGTACCGAGAGGCGATGGAAGCGGAT
TTGAAGGCTGCAGCTGAGGCTGCAGCTGAAGCCAAGGCTAGGGCCGAGATTAGAGCTCGA
ATGGGCATTGGGCTCGGCTCGGAGAATGCTGCCGGGCCCTGCAACTGGGACGAAGCTGAT
ATCGGACCCTGGGCCAAAGCCCGGATCCAGGCGGGAGCAGAAGCTAAAGCCAAAGCCCAA
GAGAGTGGCAGTGCCAGCACTGGTGCCAGTACCAGTACCAATAACAGTGCCAGTGCCAGT
GCCAGCACCAGTGGTGGCTTCAGTGCTGGTGCCAGCCTGACCGCCACTCTCACATTTGGG
CTCTTCGCTGGCCTTGGTGGAGCTGGTGCCAGCACCAGTGGCAGCTCTGGTGCCTGTGGT
TTCTCCTACAAGTGA
gattttaggtatctgccttggtttcagtggggacatctggggcttatggggctgggatga
ggagctggatgattctaggaaggcccaagttggagaatgatgtggagagtgtgccaagac
actgcttttggcattttattcctttctgtttgctggatgtcaattgacccttttattttc

Predicted peptide sequence(s):


>MAGED2_1|GENSCAN_predicted_peptide_1|606_aa
MSDTSESGAGLTRFQAEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKA
SGVSKATEVSKTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQAVTMPA
TETKKVSHVADTKVNTKAQETEAAPSQAPADEPEPESAAAQSQENQDTRPKVKAKKARKV
KHLDGEEDGSSDQSQASGTTGGRRVSKALMASMARRASRGPIAFWARRASRTRLAAWARR
ALLSLRSPKARRGKARRRAAKLQSSQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPI
KRSDMLKDIIKEYTDVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGIL
GTTKDSPKLGLLMVLLSIIFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFGDVKKLITDEF
VKQKYLDYARVPNSNPPEYEFFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME
ADLKAAAEAAAEAKARAEIRARMGIGLGSENAAGPCNWDEADIGPWAKARIQAGAEAKAK
AQESGSASTGASTSTNNSASASASTSGGFSAGASLTATLTFGLFAGLGGAGASTSGSSGA
CGFSYK