GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:27:58

Sequence MAGEA3_1 : 5987 bp : 53.92% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1648   1706   59  1  2   84   94    23 0.205   1.52
ggccagggcagggctggttagaagaggtcagggcccacgctgtggcaggaatcaaggtca
ggaccccgagagggaactgagggcagcctaaccaccaccctcaccaccattcccgtcccc
caacaccaaccccacccccatcccccattcccatccccacccccacccctatcctggcag
AATCCGGGCTTTGCCCCTGGTATCAAGTCACGGAAGCTCCGGGAATGGCGGCCAGGCAC
gtgagtcctgaggttcacatctacggctaagggagggaaggggttcggtatcgcgagtat
ggccgttgggaggcagcgaaagggcccaggccctcctggaagacagtggagtcctgaggg
gacccagcatgccaggacagggggcccactgtacccctgtctcaaaccgaggcacctttt

 1.02 Term +   3210   4219 1010  1  2  133   47   733 0.421  66.47
gtaccctgaggtgccctctcacttcctccttcaggttctgaggggacaggctgacctgga
ggaccagaggcccccggaggagcactgaaggagaagatctgtaagtaagcctttgttaga
gcctccaaggttccattcagtactcagctgaggtctctcacatgctccctctctccccag
GCCAGTGGGTCTCCATTGCCCAGCTCCTGCCCACACTCCCGCCTGTTGCCCTGACCAGAG
TCATCATGCCTCTTGAGCAGAGGAGTCAGCACTGCAAGCCTGAAGAAGGCCTTGAGGCCC
GAGGAGAGGCCCTGGGCCTGGTGGGTGCGCAGGCTCCTGCTACTGAGGAGCAGGAGGCTG
CCTCCTCCTCTTCTACTCTAGTTGAAGTCACCCTGGGGGAGGTGCCTGCTGCCGAGTCAC
CAGATCCTCCCCAGAGTCCTCAGGGAGCCTCCAGCCTCCCCACTACCATGAACTACCCTC
TCTGGAGCCAATCCTATGAGGACTCCAGCAACCAAGAAGAGGAGGGGCCAAGCACCTTCC
CTGACCTGGAGTCCGAGTTCCAAGCAGCACTCAGTAGGAAGGTGGCCGAGTTGGTTCATT
TTCTGCTCCTCAAGTATCGAGCCAGGGAGCCGGTCACAAAGGCAGAAATGCTGGGGAGTG
TCGTCGGAAATTGGCAGTATTTCTTTCCTGTGATCTTCAGCAAAGCTTCCAGTTCCTTGC
AGCTGGTCTTTGGCATCGAGCTGATGGAAGTGGACCCCATCGGCCACTTGTACATCTTTG
CCACCTGCCTGGGCCTCTCCTACGATGGCCTGCTGGGTGACAATCAGATCATGCCCAAGG
CAGGCCTCCTGATAATCGTCCTGGCCATAATCGCAAGAGAGGGCGACTGTGCCCCTGAGG
AGAAAATCTGGGAGGAGCTGAGTGTGTTAGAGGTGTTTGAGGGGAGGGAAGACAGTATCT
TGGGGGATCCCAAGAAGCTGCTCACCCAACATTTCGTGCAGGAAAACTACCTGGAGTACC
GGCAGGTCCCCGGCAGTGATCCTGCATGTTATGAATTCCTGTGGGGTCCAAGGGCCCTCG
TTGAAACCAGCTATGTGAAAGTCCTGCACCATATGGTAAAGATCAGTGGAGGACCTCACA
TTTCCTACCCACCCCTGCATGAGTGGGTTTTGAGAGAGGGGGAAGAGTGA
gtctgagcacgagttgcagccagggccagtgggagggggtctgggccagtgcaccttccg
gggccgcatcccttagtttccactgcctcctgtgacgtgaggcccattcttcactctttg
aagcgagcagtcagcattcttagtagtgggtttctgttctgttggatgactttgagatta

Predicted peptide sequence(s):


>MAGEA3_1|GENSCAN_predicted_peptide_1|356_aa
XIRALPLVSSHGSSGNGGQARQWVSIAQLLPTLPPVALTRVIMPLEQRSQHCKPEEGLEA
RGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYP
LWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGS
VVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPK
AGLLIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEY
RQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE