GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:21:22

Sequence DKC1_1 : 17210 bp : 46.14% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1292   1307   16  1  1   99  116    20 0.928   6.45
gcgcctcggattccgcccccgggatggccccgcctcctcccgccccgcggcaaggcacgc
acagggcagtgcgcgggtgggtgggtcctagcagcgcggcctgacgggaccaaggcggcg
ggagtctgcggtcgttccctcggctgtggaccgggcggcacgcacgcggtgcagggtaac
ATGGCGGATGCGGAAG
gtaagggctgcaggcttccgggccgtgctaactccgggcgactcggggaacgggggtggg
gggatggtatcggggcccgcgcacgcctccctctggttcccgccggcgtgtcggcctctt
caccgcccggccttaagccggccttgtctctcggccctggctccgtggcaagggcgcgag

 1.02 Intr +   3225   3292   68  1  2   62   78   113 0.932   6.32
taatcttatgggggccaccatcacatacgcagtctgtacttgcaaaacattatgtggcat
gtgactgtaattgtagacctaaaatccatttcctacctgccctaatttcggtctttattt
taaacccttgtttcatttattcttggggaaaattcccaaatcctgtgtttgtttttttag
TAATTATTTTGCCAAAGAAACATAAGAAGAAAAAGGAGCGGAAGTCATTGCCAGAAGAAG
ATGTAGCC
gtgagtagtaatgtgtttgacttcactttgactaaaaagaaagtttacttaaataacaaa
ctaaaggaaagaagtgtttttaaaggtttccaaggaatgggccagcattggtagtcattg
tgtagattcgaaaaagcactgaaatgacacagccccagacagtccaagtgtccttcaggc

 1.03 Intr +   4233   4324   92  2  2   73  111    18 0.988   1.39
gttgtagaacacatgtccccacaatgttaaattgctgagtttgtcaacagttctcagttt
ttgtacttagtccatcttgcagacctatgccagtttgtgggccacatagtggtactgact
ctttttttacatgtgctcacgacatggtattttgttttgtgttgtgtcgttgctttgtag
AATTTTGATAAGCTGAATGTAAGGACAACACACTATACACCTCTTGCATGTGGTTCAAAT
CCTCTGAAGAGAGAGATTGGGGACTATATCAG
gtaagtgttgggaggaggcactgtgcaaacttactttcttttgaaaatgctttcacatca
gctattcaggaaggcagtggcatgccagaatagctttgtcttgaatatataacctgtacc
cgcagtgaattatttttctttttaacttttcagatttgttgtttcactggagcattaaga

 1.04 Intr +   4542   4726  185  0  2  110   91   133 0.985  15.23
cttttgaaaatgctttcacatcagctattcaggaaggcagtggcatgccagaatagcttt
gtcttgaatatataacctgtacccgcagtgaattatttttctttttaacttttcagattt
gttgtttcactggagcattaagagtgggtgatacattaattttttttttttccattccag
GACAGGTTTCATTAATCTTGACAAGCCCTCTAACCCCTCTTCCCATGAGGTGGTAGCCTG
GATTCGACGGATACTTCGGGTGGAGAAGACAGGGCACAGTGGTACGCTGGATCCCAAGGT
GACTGGTTGTTTAATCGTGTGCATAGAACGAGCCACTCGCTTGGTGAAGTCACAACAGAG
TGCAG
gtatgtgggagagggagggaaggactggctagagtgaaaagctttctgtatttcccttct
atgttttgtctgctggaaactatttcttcattaagaaaaaaaaaaatcctaaagcaagga
tattgttttggtttctgtgtacgttctgtcccctgccagatcttggtggtccgcgctttt

 1.05 Intr +   5323   5387   65  2  2  120  110    49 0.999   8.74
gtgtcttcattctttcccacatcatcaccatgaaatctctcttaatgcaaattttataga
aacacaaggtcaaactgccgcttttcctgctgtgcaaaatgggagtgactgagcatataa
gaaatatggaaaacagaaaactcagtggccacacctgactactcttttgtcatttttcag
GCAAAGAGTATGTGGGGATTGTCCGGCTGCACAATGCTATTGAAGGGGGGACCCAGCTTT
CTAGG
gtaagtctgcaattgtagggaggacaccctttgttgacttggatctctgagcccctaaac
atctggagatgggttagctgtcctgactgactccttttgtccccttttcagtcggctgct
gcagccagcctggaccagtgactgcacatgtacattctgatgaggtgtttgttttcattt

 1.06 Intr +   5582   5708  127  1  1   85   95   170 0.997  17.65
gtagggaggacaccctttgttgacttggatctctgagcccctaaacatctggagatgggt
tagctgtcctgactgactccttttgtccccttttcagtcggctgctgcagccagcctgga
ccagtgactgcacatgtacattctgatgaggtgtttgttttcatttgtgtttgttcttag
GCCCTAGAAACTCTGACAGGTGCCTTATTCCAGCGACCCCCACTTATTGCTGCAGTAAAG
AGGCAGCTCCGAGTGAGGACCATCTACGAGAGCAAAATGATTGAATACGATCCTGAAAGA
AGATTAG
gtgagtcattaggcctgtgagtgggtatgaacacattcttcaggattctgttctcttatt
aaaagtagatgcccttgaagttgaagactttctaaaacctgccctacagctgggatattg
tctgtgggcgatagtttttgttatcttttgttgaaaaagtgaacagtgcctagtaaagtg

 1.07 Intr +   6628   6758  131  2  2   67   95    26 0.996   1.61
ttacaggcgtgagccaccgtgcctggccagaattacagatctttacagcaaatgcttata
ttttaagaagtgtgtctgtcacctctagtcttggtggctcagatgaaggataactgcatt
tctcaaccagtgatgtatttacagtaggtgctgcttttcttttgtgtgtgtgtatcttag
GAATCTTTTGGGTGAGTTGTGAGGCTGGCACCTACATTCGGACATTATGTGTGCACCTTG
GTTTGTTATTGGGAGTTGGTGGTCAGATGCAGGAGCTTCGGAGGGTTCGTTCTGGAGTCA
TGAGTGAAAAG
gtatgtgttacggggctagaagttttagagctggttcttaccatctgccagcctttgatg
gcactccacttgcttcatgtcgtgggaaagatgctttccaaagtgttgagttcagtccag
ggcagcttccctgttctgttaattaaactttgggacattaaaatgggctaagggagatga

 1.08 Intr +   7493   7636  144  1  0   79   92   134 0.996  13.38
ccgtctcaaaaaaaaaaaaaaaaaaaaaaaaaagatgcctggaagagccaggactgaaga
ggctgaagacataatgagcttggactagtaaacaagtgacattcagttttaggaagtttg
gggtctgatgggctgagatacaaataaactgaattattttcatacatggctgcttttcag
GACCACATGGTGACAATGCATGATGTGCTTGATGCTCAGTGGCTGTATGATAACCACAAG
GATGAGAGTTACCTGCGGCGAGTTGTTTACCCTTTGGAAAAGCTGTTGACATCTCATAAA
CGGCTGGTTATGAAAGACAGTGCA
gtaagttccgggttaggagtttatatttggaaagaacgtactccaaagatgaggcttgct
ctttttattgttttccttgggttttattttatttttttcaagtccaaaccaagtatatta
atttaaagtaaaagtttaatggtaggcatacttaaaaataaggcacattaggccaggcac

 1.09 Intr +   9085   9205  121  0  1   98   86   206 0.860  21.47
atagcacagtgaggtggctcttctgagtaccactcatgccccttgcagctagtgggctat
aagtgtcatccctgtttcctggtgtcaggccccactcccttgttgtcctcctttactctg
gtgtgggagtggggtggagggcagcagctgggccccttacacttggtgccatctctgcag
GTAAATGCCATCTGCTATGGGGCCAAGATTATGCTTCCAGGTGTTCTTCGATATGAGGAC
GGCATTGAGGTCAATCAGGAGATTGTGGTTATCACCACCAAAGGAGAAGCAATCTGCATG
G
gtaagaggggatgtttattttttaaattctaaatgtttgtggttacatactaggtgtata
tatttatggggttcatgagatgttttgatacaggcatgcaatacataataatcacatcat
ggagaatggggcatccatcttaagcatttatcctttgtgttacaaacaatcctattttac

 1.10 Intr +  11457  11575  119  1  2   72  115    83 0.997   9.58
ctccttctcataatggagtatttcctccatatgcacatcctgagcaaaggtaaccccaat
taaagtagtagctcagagttttaaaagttttaaagtggcatacaacagtagaattggggc
tcatcaattatcaattctttcacccttcaaataattcttttctttattcaatgcctgtag
CTATTGCATTAATGACCACAGCGGTCATCTCTACCTGCGACCATGGTATAGTAGCCAAGA
TCAAGAGAGTGATCATGGAGAGAGACACTTACCCTCGGAAGTGGGGTTTAGGTCCAAAG
gtaagtggtactgggttgcgtgccctgccaggttcttttttttttttttttttttttaaa
tttatttttttattgataattcttgggtgtttctcacagagggggatttggcagggtcat
gggacaatagtggagggaaggtcagcagataaacaagtgaacaaaggtctctggttttcc

 1.11 Intr +  12928  13031  104  0  2   61   94   139 0.997  10.77
tgatcttcaacaagtcctgtgtgtgttggagttagtgggcaaattctgaatgctctggag
aggagtttgaggccctgctgagaatacaccagggaggaaccttgttctattctttgtagt
caccatgcccgcttccagcattgacaccattctaatgttgacaccttgatgttccaccag
GCAAGTCAGAAGAAGCTGATGATCAAGCAGGGCCTTCTGGACAAGCATGGGAAGCCCACA
GACAGCACACCTGCCACCTGGAAGCAGGAGTATGTTGACTACAG
gtgagggcaggatgtttcagagccggggtgggtagagacggcacacttgctgccttgatg
caggagtatgtcaacaacaggtgaggatgggaaggtagagcccacttgccatctggacgc
aggagtacatggacaacaggtgaggaacaggtgagcatggaggttgtagagcccagggga

 1.12 Intr +  13521  13599   79  0  1  100  113   103 0.997  13.55
tttctagtctggctcgtgggactctagagggagtcagtctgcaacagtaagtggtgagtt
cttctgtccagcgtcagtattttgatggtggctttagacttgccagataacactacataa
catcagtactgccctggaaagccattcagtgaatttgacctattgctacctctttttcag
TGAGTCTGCCAAAAAAGAGGTGGTTGCTGAAGTGGTAAAAGCCCCGCAGGTAGTTGCCGA
AGCAGCAAAAACTGCGAAG
gtgagtggcatgctgtcctcagtttggaatgtgcttagggagataatcctaagaggcact
ggcattcgtcttactttgtgactgtccgcagtccagccatatacgctagcatcagaggtg
cagcgcatacacaggtaatgctgcctcataccctggggtgcttgtttgggctctgcaggc

 1.13 Intr +  14513  14650  138  1  0   58   49   183 0.994  12.06
gggatgagactgtcttcaaatcctcagtaaactaaggccctgtccgggtttgtagtcaga
aaacgtcctgttagattcagttgggatctttcttggtgccttgctaccttttgactcact
gaacctttcttgtccattattgcccaagatctaacacttaaccaattgctttcatctcag
CGGAAGCGAGAGAGTGAGAGTGAAAGTGACGAGACTCCTCCAGCAGCTCCTCAGTTGATC
AAGAAGGAAAAGAAGAAGAGTAAGAAGGACAAGAAGGCCAAAGCTGGTCTGGAGAGCGGG
GCCGAGCCTGGAGATGGG
gtgtgtggaaacacgttcaggttccttgggctggcttagtccctgcgtggggaaagaatt
acccaggtggtaccagctttgttactcttcttggaggagctgtggcctgggggtgggatg
ccaccgagtgcctttagtgcttccccatgttcctggagtgcttttgccctccctgtggaa

 1.14 Term +  15125  15193   69  1  0  116   40   129 0.926   8.84
ctagggtgtcactgaaaggtttacagaactttgtgtcacatgcagcatttaacccaaaat
atccttacaggtcctgaaaaaggcttgcttgactgtggacctttaccagatttccttctg
ggagagtcatagctttgttagtggatggtatctgtgagctttcattctctttctttctag
GACAGTGATACCACCAAGAAGAAGAAGAAGAAGAAGAAAGCAAAAGAGGTAGAATTGGTT
TCTGAGTAG
tgaaggccacttgaagctggaggagaaactaaagccttattgagaaaacatgttatagat
ccttttgttgctgagagagtggaacataggtcctagacagggtgaagagttctggcacat
tttagctgctactttgagacctcggtgatgttacctggtgtggtcatcccatcttgtcct

Predicted peptide sequence(s):


>DKC1_1|GENSCAN_predicted_peptide_1|485_aa
MADAEVIILPKKHKKKKERKSLPEEDVANFDKLNVRTTHYTPLACGSNPLKREIGDYIRT
GFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSA
GKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDP
ERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDA
QWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEV
NQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQK
KLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKR
ESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEV
ELVSE