GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:19:31

Sequence CXCR3_1 : 5000 bp : 55.64% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1197   1280   84  2  0   95  107    27 0.706   5.81
gccagtcatcctctgcccagcttttctggtcccaagcttgtagccagctcctccagagag
gtttcacccagtcacggaaactctgtggcctgaggtttagggaggtctggtagaggtaac
tccctggaagaggctgctgctgagaactgcctgaaactcccacttcctctgtgactgcag
GTTTCCAACCACAAGCACCAAAGCAGAGGGGCAGGCAGCACACCACCCAGCAGCCAGAGC
ACCAGCCCAGCCATGGTCCTTGAG
gtaagtgctgctgcccagccaggccaggccagaattcgaagtggaaaacccggggcatca
ggggaatgccagggctggcccacagcccagggtcaccacagggttgggtgagtagctgga
ggccgcatgggttgtggcagaaacagcactggggaattgggaacccagcttggccactga

 1.02 Term +   2259   3353 1095  2  0  123   54  1732 0.762 165.92
cactatcccagagcccaggctgagcggatggagttgaggaagtacggccctggaagactg
gcggggacagttataggaggagctgctcagagtaaatcacagactaaatcagactcaatc
acaaaagagttcctgccaggcctttacacagccccttcctccccgttcccgccctcacag
GTGAGTGACCACCAAGTGCTAAATGACGCCGAGGTTGCCGCCCTCCTGGAGAACTTCAGC
TCTTCCTATGACTATGGAGAAAACGAGAGTGACTCGTGCTGTACCTCCCCGCCCTGCCCA
CAGGACTTCAGCCTGAACTTCGACCGGGCCTTCCTGCCAGCCCTCTACAGCCTCCTCTTT
CTGCTGGGGCTGCTGGGCAACGGCGCGGTGGCAGCCGTGCTGCTGAGCCGGCGGACAGCC
CTGAGCAGCACCGACACCTTCCTGCTCCACCTAGCTGTAGCAGACACGCTGCTGGTGCTG
ACACTGCCGCTCTGGGCAGTGGACGCTGCCGTCCAGTGGGTCTTTGGCTCTGGCCTCTGC
AAAGTGGCAGGTGCCCTCTTCAACATCAACTTCTACGCAGGAGCCCTCCTGCTGGCCTGC
ATCAGCTTTGACCGCTACCTGAACATAGTTCATGCCACCCAGCTCTACCGCCGGGGGCCC
CCGGCCCGCGTGACCCTCACCTGCCTGGCTGTCTGGGGGCTCTGCCTGCTTTTCGCCCTC
CCAGACTTCATCTTCCTGTCGGCCCACCACGACGAGCGCCTCAACGCCACCCACTGCCAA
TACAACTTCCCACAGGTGGGCCGCACGGCTCTGCGGGTGCTGCAGCTGGTGGCTGGCTTT
CTGCTGCCCCTGCTGGTCATGGCCTACTGCTATGCCCACATCCTGGCCGTGCTGCTGGTT
TCCAGGGGCCAGCGGCGCCTGCGGGCCATGCGGCTGGTGGTGGTGGTCGTGGTGGCCTTT
GCCCTCTGCTGGACCCCCTATCACCTGGTGGTGCTGGTGGACATCCTCATGGACCTGGGC
GCTTTGGCCCGCAACTGTGGCCGAGAAAGCAGGGTAGACGTGGCCAAGTCGGTCACCTCA
GGCCTGGGCTACATGCACTGCTGCCTCAACCCGCTGCTCTATGCCTTTGTAGGGGTCAAG
TTCCGGGAGCGGATGTGGATGCTGCTCTTGCGCCTGGGCTGCCCCAACCAGAGAGGGCTC
CAGAGGCAGCCATCGTCTTCCCGCCGGGATTCATCCTGGTCTGAGACCTCAGAGGCCTCC
TACTCGGGCTTGTGA
ggccggaatccgggctcccctttcgcccacagtctgacttccccgcattccaggctcctc
cctccctctgccggctctggctctccccaatatcctcgctcccgggactcactggcagcc
ccagcaccaccaggtctcccgggaagccaccctcccagctctgaggactgcaccattgct

Predicted peptide sequence(s):


>CXCR3_1|GENSCAN_predicted_peptide_1|392_aa
VSNHKHQSRGAGSTPPSSQSTSPAMVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDS
CCTSPPCPQDFSLNFDRAFLPALYSLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLA
VADTLLVLTLPLWAVDAAVQWVFGSGLCKVAGALFNINFYAGALLLACISFDRYLNIVHA
TQLYRRGPPARVTLTCLAVWGLCLLFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALR
VLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVL
VDILMDLGALARNCGRESRVDVAKSVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRL
GCPNQRGLQRQPSSSRRDSSWSETSEASYSGL