GENSCAN 1.0	Date run: 17-Jan-104	Time: 04:04:39

Sequence BTK_1 : 39140 bp : 43.48% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   7703   7786   84  1  0   91   82    54 0.966   5.92
agtatagttgacagttaccagagacagatcatccttaccagcctggaggaatattgcaga
ggaaagagcttaggatcttgaatactctcttatctcctgtatttaccaccatttcctctc
ttgctgaacattcctagaaaatggagaggagtttgtcacaactgctctttgatgatagcc
ATGGAGAATGACAGGGGCCCCAAGGCAGATGGCATCAACCTCATCAAAGACCAAAAAACA
AATAAACGAACAAAAATCCCTCCG
gtaggcagtgaaacaccacaaaaaaagcaagggctatagatgatataccaagagctacag
atggatgaggttggacaagtcacataacctctgtgtcagtttcctcatctgtttgttgtg
aggaataaatgaaataatgcctgtaaaatgcctgtcaggtagaagtcactgaaaggaaca

 1.02 Intr +  12081  12251  171  2  0   42   98   196 0.972  16.14
catccattatacctgaaacctgacagagctgggggctgtgggaggaggttggtaggaaga
aattattttgtgagctgtgcacatttttgttccatttgaaactaggtagctaggctgagg
gggaaccaagagggatgaggattaatgtcctgggtcctcaggaactttcattatcaacag
CACACAGGTGAACTCCAGAAAGAAGAAGCTATGGCCGCAGTGATTCTGGAGAGCATCTTT
CTGAAGCGATCCCAACAGAAAAAGAAAACATCACCTCTAAACTTCAAGAAGCGCCTGTTT
CTCTTGACCGTGCACAAACTCTCCTACTATGAGTATGACTTTGAACGTGGG
gtaagtttctcgactatgaaaactgagtttcaagatatcaaggacttggccttagatctt
tcttggggaagaggtaaattttcgttggtaggaggaggggagtagaatggacctaagttc
tttcaaattcagcaaaatatttcctagcctataactagctaaagccggaaagtcaaaggt

 1.03 Intr +  12761  12859   99  1  0   81  111    38 0.981   5.71
atttgccctccatttggtagtcatagatttatagatctggaaggatttttttttcttccc
ccacatgacaggtcctggtgccacctcactttgttgaatgattagataacaaaatctaat
catctggttgcttaatccctcttaatctttctccattttcttcctcattctacttctcag
AGAAGAGGCAGTAAGAAGGGTTCAATAGATGTTGAGAAGATCACTTGTGTTGAAACAGTG
GTTCCTGAAAAAAATCCTCCTCCAGAAAGACAGATTCCG
gtaagaagagaccaatgtctgagatggggaacagcagatttgaagaaatttgcaacattt
aaattctctgtaaatagactggtgatgctgtgcaacgtggaacacggtcaagtttccttt
aaaaattcttcactctaccatattggttataaagaatcttagcttctttccttcatattc

 1.04 Intr +  15694  15762   69  0  0   92  109    47 0.990   6.58
tatgtgttgggtcgtattggatatgtgtccctattggcctatagaaagtaatcactaaga
atcagccttgtctgtgcaggagaaacttctgaagccacagcaaaaggcttctagtaccta
aggaaattcagaaaagagcaatgcatcaaccaataaccattttttcttatttcattacag
AGAAGAGGTGAAGAGTCCAGTGAAATGGAGCAAATTTCAATCATTGAAAGGTTCCCTTAT
CCCTTCCAG
gtgagttattttctctcaccaaatctcgaaaggcccctgtaacacaattagaaggggtgg
tggggtgcagggcagagggaaggctacgaggacccagtgaatagaagttgaggtggacaa
ggatgctgaaccaagaaatgagactggcatgggctaagaatgtttgcttttctatttacc

 1.05 Intr +  17316  17397   82  2  1   85   93    66 0.988   6.01
aagagttcaggaatccttcagatagttcacataacctgaacaccattgctgactgaagat
tctgcctttctttgttttctacaataaatatacaaattgtcccctaagattagtactttc
aaggtctttctccttttttctgaatcctaactgctgaagtctgtgttttcatcgacccag
GTTGTATATGATGAAGGGCCTCTCTACGTCTTCTCCCCAACTGAAGAACTAAGGAAGCGG
TGGATTCACCAGCTCAAAAACG
gtgagaattatttggaaaataaatgtttccaaagaaagaaggaaaggaaggaagaggaga
tagacgggaggaaaaggaaagaaggaagagagaaacgagaaagaaagagaaaggagaaac
gtagagagaaaagaagaaaaaaatggatagaaggggagaaaagaaagagagagggagggg

 1.06 Intr +  24706  24834  129  2  0   95   74   133 0.998  13.27
cagggcacagtcaggcaggccagtcatgtgagccaactggtcctgtgatctgctctcctt
cagggtggccaaggagggggcagttgcttgaagttcaccactaagctcaaagaggaaaac
atgcaaatggtggcttctcctccatgtcagatgtgatctctctcttctttcctgctacag
TAATCCGGTACAACAGTGATCTGGTTCAGAAATATCACCCTTGCTTCTGGATCGATGGGC
AGTATCTCTGCTGCTCTCAGACAGCCAAAAATGCTATGGGCTGCCAAATTTTGGAGAACA
GGAATGGAA
gtaagcaatctgatcgatataatttctttctcctttgactgtttccatcactctcccaag
ggtctgtcaagcccagggtcatagcataaggttgtacactttgggtgctaaacaaagggt
cctgggggagggaggaggcacatgggggctgaaatccagctggtaatctgctctccaagc

 1.07 Intr +  25155  25222   68  1  2   97   74    31 0.975   1.22
catgggggctgaaatccagctggtaatctgctctccaagctatgtgacctggcatgccta
gctactttttctaacttgcctaaaggcactcaatatggacggcaaagtccctgaccaaac
ctgtccttggcccctttcctaaagtgcattccatatcatcactggcttcttgttttgcag
GCTTAAAACCTGGGAGTTCTCACCGGAAGACAAAAAAGCCTCTTCCCCCAACGCCTGAGG
AGGACCAG
gtatacagggaaactgggtgctgccactgcttaaatggaaacttatagtcaagccctaag
aacacactagagtcttagaattaccctgggacttggcagtgttaattggtattcttgcta
agatgggggatttgttcttctaattaggatttcctcctcgatggaaagatagaaggctct

 1.08 Intr +  26640  26827  188  2  2   56   92   111 0.974   6.79
tatatgtgtgcaaggctgagaactcctgcactggtgcttaaaaatggttgttgaatgact
gctgagtaatattttagtatgcctgatttgggtgtcttgagtaagccagagagttgggag
agaagagaagagtgcttggtatcttgacaaaccctcctaccttttctcctaactacatag
ATCTTGAAAAAGCCACTACCGCCTGAGCCAGCAGCAGCACCAGTCTCCACAAGTGAGCTG
AAAAAGGTTGTGGCCCTTTATGATTACATGCCAATGAATGCAAATGATCTACAGCTGCGG
AAGGGTGATGAATATTTTATCTTGGAGGAAAGCAACTTACCATGGTGGAGAGCACGAGAT
AAAAATGG
gtgagtccacaccagcccttcctgagcctggtgcctgcccactccctacacgcaaaaagt
gctgcggcataattcccgtgatcagcatcctcatcagagactgttcttcccacaccagac
tgaacatgctctccctccaagtacttcccagcgtgcagctccctatacatggcctctgcc

 1.09 Intr +  27245  27307   63  2  0   93   80    57 0.884   3.23
ctgcacctcactggctcactgcctaaccatgcatcagagacatgattgtctttgagggag
gtgcatgatacatatacctccatttgagatttgttctgagctcagggacgtgggcatatg
aatctgtctcctggaggctggggaggtgctggatgaactgccacattgtttccttcacag
GCAGGAAGGCTACATTCCTAGTAACTATGTCACTGAAGCAGAAGACTCCATAGAAATGTA
TGA
gtaagtatgtttatgtcagtccacaatcttccaggaggaactctctctctctatatatat
atatatttatttatttatatatattttatatatatttatatatatatataacacacacaa
gtgtatatatgtatacatatgtatacatacactggtgtatatataggtatattatgtata

 1.10 Intr +  28048  28102   55  1  1   92  107     7 0.994   1.98
tcttcaatgccaacctgggtttgggaaagggatacagtgtgctatgcacatgacagatgc
tcagtaaatagggtttgagtgagttgactgaatcactgacatggacaagccctggagggt
gctgtaacctccaatctgcttatgaccaggagccactcaagcagcactctcccttcacag
GTGGTATTCCAAACACATGACTCGGAGTCAGGCTGAGCAACTGCTAAAGCAAGAG
gtaagtgtggaaccactagcacacagcattctccttgcataagtgaggatcttgaactga
gggcctgttctgccccctacctttgggcaaggcagtgtcaaagctgccatcgtctgggat
cccaattacaccattttttttgtttttgtttttctgagacggactctcggtctgtcaccc

 1.11 Intr +  28699  28778   80  0  2   94   96    57 0.908   5.45
catgagccaccatgcccggcctgcaccttttaatattaaaagcaatgaggctgtagctca
agcgtggaacttggcagtaaaatcaggggttgttctattttctctctcaagtttgggcag
gtgggatgcaggtgtgagcaccacttcctcctacagacagcttctttttcgttgtttcag
GGGAAAGAAGGAGGTTTCATTGTCAGAGACTCCAGCAAAGCTGGCAAATATACAGTGTCT
GTGTTTGCTAAATCCACAGG
gtgagtgctactattccaaggccctgaggacaaagaacaggggtaccctcctaatagctc
cttgatgctgtgcccgtcccacttcctctgtctctgaaactcaaaactcatctcacttca
cttcctgggttctgttgacctttgtgcccaagttactgactaagcatccacttcttcagg

 1.12 Intr +  28958  29085  128  2  2   60  109    78 0.901   7.42
ggtgagtgctactattccaaggccctgaggacaaagaacaggggtaccctcctaatagct
ccttgatgctgtgcccgtcccacttcctctgtctctgaaactcaaaactcatctcacttc
acttcctgggttctgttgacctttgtgcccaagttactgactaagcatccacttcttcag
GGACCCTCAAGGGGTGATACGTCATTATGTTGTGTGTTCCACACCTCAGAGCCAGTATTA
CCTGGCTGAGAAGCACCTTTTCAGCACCATCCCTGAGCTCATTAACTACCATCAGCACAA
CTCTGCAG
gtgagtaccaggggcaactgagaagggagttacagacaccaggataagcaatgcaggaca
aggtgataagaggaagaatctgcctcacaggacagtgtgaattcactgtgaaaggaaatc
cctgtgatactgggtagaagctggtaaagaggtggtcagaggcagacctacacccaacag

 1.13 Intr +  30371  30611  241  0  1   51   76   249 0.440  16.61
atcataaagggatttggggaggttgcttagtctatcttcttgccttatggccaccttgaa
cctaaaattcccagattcctctaaccaatgaatcccgtttctgagattgacttaagcaaa
gacagattagtacttctaaaaatttcccttttactagttttcctatttctaccccagtag
GGATTTTTGTCTATTGTAAGAATTATACATTCATGACCCCAAAGAATCACACCAAGACTT
TATTGTTAGGATCATGGGAAATTGATCCAAAGGACCTGACCTTCTTGAAGGAGCTGGGGA
CTGGACAATTTGGGGTAGTGAAGTATGGGAAATGGAGAGGCCAGTACGACGTGGCCATCA
AGATGATCAAAGAAGGCTCCATGTCTGAAGATGAATTCATTGAAGAAGCCAAAGTCATGA
T
gtgagttatagcccaaactcaactctcaatctatttgctggagtctaggaattcacacaa
caacccactgaggcttaaagatgacttacagtaagagaggtttgggacgagggactgaag
tttacctttaactggcggtagtcctaagtgctaagataatagtttctgtgccttagatat

 1.14 Intr +  31127  31343  217  2  1   45   48   337 0.855  23.91
cctgcttgcttccacattttaagcacttttgagatttagggtgggaaagaggaaaataaa
cttgctggtgtgaccccttatctgatgctctactcctaggtcagccccttcctccccagc
ccctttattgctattatgcagagccaaaaggagaagactagttccttgcctttcctgtag
GAATCTTTCCCATGAGAAGCTGGTGCAGTTGTATGGCGTCTGCACCAAGCAGCGCCCCAT
CTTCATCATCACTGAGTACATGGCCAATGGCTGCCTCCTGAACTACCTGAGGGAGATGCG
CCACCGCTTCCAGACTCAGCAGCTGCTAGAGATGTGCAAGGATGTCTGTGAAGCCATGGA
ATACCTGGAGTCAAAGCAGTTCCTTCACCGAGACCTG
gtgggaccttagaaggattggcctaggacaaagggctgatggggtggaagtagcagtgga
agatatatcatacatggttgaggggggctgctggtgccatcatttcaattttatctagaa
agtactataagttaggcgtgcctctgccccagtgctgagcccatcaaatatctccagcct

 1.15 Intr +  32701  32765   65  0  2   95  109    49 0.999   5.22
acgtggtggaaatgaatcaaaatttcttggtggcatcaacagattcctattaggtgggaa
ggtgtctgtagtcgaaggagatgaagcttccctggcttcattctactggtcagcagaagc
tttgtgcctttaacctctgtgctggggacggagtctcactggtctctgtttgcactacag
GCAGCTCGAAACTGTTTGGTAAACGATCAAGGAGTTGTTAAAGTATCTGATTTCGGCCTG
TCCAG
gtgagtgtggctttttcatctttccctccagaagtaaaaatagcacagtatgaaacatgg
gtaggtgttacagttttaatcctctccttttcttttttttctcattctagcgttttctgc
cgatctttctattctttttcttcctctgagttatttaagccacctctttcatccttttgt

 1.16 Intr +  33407  33525  119  2  2   80  111   109 0.999  12.51
aatcagatacaaaaacaggaaattcgttaaaagtaacgtttgtagaagatactagttgag
gaggagagacttttgagaaagcctgtgtgtgtttgtgacactcttgtgaccgtgccaaga
aaacgtaagcaaatatcaagcctccaaatcctaatgcaacaagtcctgaatcccttgcag
GTATGTCCTGGATGATGAATACACAAGCTCAGTAGGCTCCAAATTTCCAGTCCGGTGGTC
CCCACCGGAAGTCCTGATGTATAGCAAGTTCAGCAGCAAATCTGACATTTGGGCTTTTG
gtaagtggataagattacacagattatacagctcaaaggataagaaatgcaatgggaaaa
ttcacactttgcaacctccacagagatattgttcttgctttcattcttccaatccttggg
gagtgcttactgtgtgtcagccaccacaggggtttctgaggatgaaaactaaactggaca

 1.17 Intr +  34044  34201  158  1  2   81  107    61 0.957   7.03
tagtacgaccttgatctccatctagtgtggtcagtactatagcagaaatttgggcaaaat
ataaaaagcacagagcggggaaccaactgattctaatctttgaggttgatctaggaagac
taggacccctgctatccaaaaagactgcaaaccaatttaataatttttttcaccttctag
GGGTTTTGATGTGGGAAATTTACTCCCTGGGGAAGATGCCATATGAGAGATTTACTAACA
GTGAGACTGCTGAACACATTGCCCAAGGCCTACGTCTCTACAGGCCTCATCTGGCTTCAG
AGAAGGTATATACCATCATGTACAGTTGCTGGCATGAG
gtaagtgctttattaggatctcttaaattatttccttgaatctacttgcccatttagctg
gccattcagccaccaaagactgatagctgcacacattcttttttttcctttttttttttt
tttaatttgagacaaggtctcgctctttcacccaggttggagtacagtggcgcgatcttg

 1.18 Term +  37439  37510   72  1  0   95   49    73 0.840   2.01
gcacaaagactttatggagagctgctatttcttttttttttttttttccttttgtaatcg
acagggcatgctactgggcatagagcatatatttaataaacatttgctgcttactcattg
catttcccttgaattctggattctagccactctaacactttactttttctttggttttag
AAAGCAGATGAGCGTCCCACTTTCAAAATTCTTCTGAGCAATATTCTAGATGTCATGGAT
GAAGAATCCTGA
gctcgccaataagcttcttggttctacttctcttctccacaagccccaatttcactttct
cagaggaaatcccaagcttaggagccctggagcctttgtgctcccactcaatacaaaaag
gcccctctctacatctgggaatgcacctcttctttgattccctgggatagtggcttctga

Predicted peptide sequence(s):


>BTK_1|GENSCAN_predicted_peptide_1|695_aa
MENDRGPKADGINLIKDQKTNKRTKIPPHTGELQKEEAMAAVILESIFLKRSQQKKKTSP
LNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRR
GEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKY
HPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPL
PPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEG
YIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAK
STGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGIFVYCKNYTFMTPK
NHTKTLLLGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIE
EAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKD
VCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWS
PPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASE
KVYTIMYSCWHEKADERPTFKILLSNILDVMDEES