GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:10:06

Sequence ARSF_1 : 48294 bp : 39.81% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   6509   6564   56  1  2   69   94   122 0.889  11.71
agacccctgttgtgttgtgttgggaggtggatcctgaatccacccagagaagcctgatac
caataaaatccctgcttgctttccaggagacccttggtcttcatgtctttggtgtgtgca
ctcttgaacacatgccaggcacacagggtgcatgacgacaagcctaatattgtcctaatc
ATGGTTGATGACCTGGGTATTGGAGATCTGGGCTGCTACGGCAATGACACCATGAG
gtaaggcggtttcatggccagtcatacgttcgtcagtcgttcaggttcagcaggctggct
gtacggctgcatctatgtgcaaaaccaaatgtatttgttgggacttttttttaagttact
ttaaactttttgatagttttaaattatttagattatgtaatagttttacaattacatttt

 1.02 Intr +  10937  11058  122  2  2  129   85   110 0.995  14.02
ctgtctctctctctgcctcgctttctgggtctctccctctctccctgtctgtctctcctc
tctctttccacctgtgcctttctgtttgtccttctctgtcttcctctcgctcttcctctc
tgcttcccccgccccccaccttttccttctctccaatacaccttccctctcccccttcag
GACGCCTCACATCGACCGCCTTGCCAGGGAAGGCGTGCGACTGACTCAGCACATCTCTGC
CGCCTCCCTCTGCAGCCCAAGCCGGTCCGCGTTCTTGACGGGAAGATACCCCATCCGATC
AG
gtgcgcaaactggcgggctctgctgggctctgccctcatgttaggatgtgaggaaacaaa
aatgtggcttgaccacgttaacaagtaaaaaagggctgggcacgatggctcacgcctgta
atcccagaacttcgggaggccaaggtgggaggattgcttgagcccaggagtttcaaacca

 1.03 Intr +  15280  15402  123  2  0   47   82    55 0.517   0.44
tgtaagggcactgattccattcttgaggctccaccctcctgacctcatcccctcctaaaa
gccctacctcctaaccattaccttgcagatgaggatttcaatgtgcaaattttgtagtga
caaaaatattccctctgtagcaacacctactcattgtacttttttccacactacatctag
GTATGGTTTCTAGTGGTAATAGACGTGTCATCCAAAATCTTGCAGTCCCCGCAGGCCTCC
CTCTTAATGAGACAACACTTGCAGCCTTGCTAAAGAAGCAAGGATACAGCACGGGGCTTA
TAG
gtaagacacaagaattggtgttagtcattgatcataaggtaatcatgtcctttgttctac
ccttgatttatgactttcttggaaacgctgtattttacaatgtcttatgtaaaggcgcag
tggcccatgcctacaatcccagtactttgggaggccaaggtgggaggatcgctggaaacc

 1.04 Intr +  18632  19055  424  0  1   64  121   267 0.558  19.60
gaacaaaaaaaatgtggctaagtggcactcggattttttagaggaaggagaatatctctg
ctactttatttttgtgtattagctgattgtttcacgtgaagaatgctcacatggtttttg
caatgtgctggcatatgttgacatattgatgcgtagatgtgtttgtgtgtttggttttag
GCAAATGGCACCAAGGCTTGAACTGCGACTCCCGAAGTGACCAGTGCCACCATCCATATA
ATTATGGGTTTGACTACTACTATGGCATGCCGTTCACTCTCGTTGACAGCTGCTGGCCGG
ACCCCTCTCGTAACACGGAATTAGCCTTTGAGAGTCAGCTCTGGCTCTGTGTGCAGCTAG
TTGCCATTGCCATCCTCACCCTAACCTTTGGGAAGCTGAGCGGCTGGGTCTCTGTTCCCT
GGCTCCTGATCTTCTCCATGATTCTGTTTATTTTCCTCTTGGGCTATGCTTGGTTCTCCA
GCCACACGTCCCCTTTATACTGGGACTGCCTCCTCATGCGGGGGCACGAGATCACGGAGC
AGCCCATGAAGGCTGAACGAGCTGGATCCATTATGGTGAAGGAAGCGATTTCCTTTTTAG
AAAG
gtaagcggaataattacaaattcatgtaataatgataatgatctcttttttaaaaggacc
tagatagatctgtagggtgattgtagtttataataatctattgtacacttctaaatagct
aaaagagaataagtcaaatggctctagaataaagaaaagacaaatatttaaggtgatgga

 1.05 Intr +  23885  24021  137  2  2   46  106    65 0.291   3.39
tgaggtgctgcaggatcatggagtccattctatgcaggatggggcccttgggtggaccca
ctctatcttctgcagcttggagaagaaggaagcaggtcatgtctatgagaagccaaaaca
atagttttcacattcatagatattgaaaactcacaagtagtttcattgatgtcttctcag
GCACAGTAAGGAAACTTTCCTTCTCTTTTTCTCCTTTCTTCACGTGCACACACCTCTCCC
CACCACGGACGATTTCACTGGCACCAGCAAGCATGGCTTGTATGGGGATAATGTGGAAGA
GATGGACTCCATGGTGG
gtaagtcacaggacttaagtggacagaaactaacgtgttctgataggacaggacacctga
aaactgctcttggtcaacctgtagagtgaagagaattatgcctatgggacagagtggtct
gagacattaatgaggtaatagttgctagcaattgagaaagtcagcaaaaaaactatatgc

 1.06 Intr +  25676  25720   45  0  0   77  119     7 0.159   0.16
gtttttccatgttacccaggctgctcttgaactcccaagctcaggtaatatgcctgcctc
agcctctcaaagtgctgggatgacaggcatgagtcactgcacccagcccacatatctttt
tgatagaaagagaaatcatattttcagactctttagtgacatagccaaactttatttcag
GTCTGTTGAGCACCAATATCTTAGTTGGGGATTGGGAATTAACTG
gtaagtcagaatccagtaccctcatgaactcatcctgtagagagaacaatgtaaatggga
cgtcctaggacttacatggtaaatgtattgattagcaaaatggctttaattttccaacat
taatgaaagaaaaccatgagtgaaactcacatatatgcaggacacaaatttaaagtataa

 1.07 Intr +  35476  35610  135  2  0   70  100   122 0.984  11.22
tttttctctttcaatggtttgtcaatttaaactgttaatgcacatttcttttcttttgtg
gcttttgacatagggtcacaccatccttgttttcctttagatagctcatgcccatttgac
ttaggggtgaaatacctcataatgtcattatttttacttgtctcttgtatattattttag
GCAAGATTCTTGATGCTATCGATGATTTTGGCCTAAGGAACAACACCCTTGTCTACTTTA
CATCAGATCACGGAGGGCATTTGGAAGCTAGGCGAGGGCATGCCCAACTTGGTGGATGGA
ATGGAATATACAAAG
gtgaggagaggaactcatgcaagtgatctggtggtgaataagcttttttgtggttcttat
aattaaagcccatgacacaaaggaatgaggcctgaaaaactgaacaagtttgtttaattt
gactcttagtaaaatgaagtattggaccaaggtcaagaaaattggtcttacatttgttaa

 1.08 Intr +  38151  38313  163  1  1   73   64    77 0.930   1.91
cagcagcacaggaaaatataattctgtagacgtgcactacttaccccactaggactctac
atagagtagacactatacaaatgtgatctcttttgatactagcttaccttttaaatacat
tcaatacagtgactattttaactaggcacaataattgaacttaattgcattgtcttatag
GTGGAAAAGGCATGGGGGGCTGGGAAGGTGGAATCCGCGTCCCAGGAATTGTCCGATGGC
CTGGAAAGGTACCAGCTGGACGGTTGATTAAGGAACCTACAAGTTTAATGGATATTTTAC
CAACTGTCGCATCAGTGTCAGGAGGAAGTCTCCCTCAGGACAG
gtgatgtcatataaactgttaacaagagcttattttcacccttcttccttctcagaagat
tcagaacaaggagactgactctatcctggcagacccactttttccctagtatctacacag
ttttaccttcctatatgactgtgtctattcagcatttttcagaagagaccagtcttttct

 1.09 Intr +  44517  44641  125  0  2  114   79    77 0.891   8.71
ttctcttgtccactggagtgtaatctcccagagagcatgcatgagttttcctaaagactc
agtacgctgtcctctggacctgaggcatgacgcagtcttcaccaagtacccttcaggtag
cttgggacccaacgtcccttctcctcattttccttatctgcactgtctgtgtctctgcag
GGTCATTGACGGCCGAGACCTCATGCCCTTGCTGCAGGGCAACGTCAGGCACTCGGAGCA
TGAATTTCTTTTCCACTACTGTGGCTCCTACCTGCACGCCGTGCGGTGGATCCCCAAGGA
CGACA
gtgagtgctcaacccgttgcttcctgttccctgccaggagcagggtcactcaggtgtatc
ctgaacgcattcttcctttcctctctagaccggtcctttcattccagggctcactgaaca
catggttttggagaagtttctcagaattgctcttctgcagaaaggcaggtgggggtaatg

 1.10 Term +  46563  46945  383  1  2  124   32   272 0.438  19.22
aagcttcgctctctcccccaaccactcacctcctgtgtgtgaccaggttcttaacaggcc
acgaacaggtaccagtttgtggcctggggactggggacccctgctatagaacactaggac
ttcttcctttgatctggctgaagtgcgcatcatttgacgagtctctcttttctcctccag
GTGGGTCAGTTTGGAAGGCTCACTATGTGACCCCGGTATTCCAGCCACCAGCTTCTGGTG
GCTGCTATGTCACCTCATTATGCAGATGTTTCGGAGAACAGGTTACCTACCACAACCCCC
CTCTGCTCTTCGATCTCTCCAGGGACCCCTCAGAGTCCACACCCCTGACACCTGCCACAG
AGCCCCTCCATGATTTTGTGATTAAAAAGGTGGCCAACGCCCTGAAGGAACACCAGGAAA
CCATCGTGCCTGTGACCTACCAACTCTCAGAACTGAATCAGGGCAGGACGTGGCTGAAGC
CTTGCTGTGGGGTGTTCCCATTTTGTCTGTGTGACAAGGAAGAGGAAGTCTCTCAGCCTC
GGGGTCCTAACGAGAAGAGATAA
ttacaatcaggctaccagaggaagcctttggtcctaacgagaagagataattacaatcag
gctaccaaaggaagcactaactttggtgctttcaagttggcaaggagtgcatttaatagt
caataaattcatctaccattccagattattaaaggcccactggttgttccacttgctgct

Predicted peptide sequence(s):


>ARSF_1|GENSCAN_predicted_peptide_1|570_aa
MVDDLGIGDLGCYGNDTMRTPHIDRLAREGVRLTQHISAASLCSPSRSAFLTGRYPIRSG
MVSSGNRRVIQNLAVPAGLPLNETTLAALLKKQGYSTGLIGKWHQGLNCDSRSDQCHHPY
NYGFDYYYGMPFTLVDSCWPDPSRNTELAFESQLWLCVQLVAIAILTLTFGKLSGWVSVP
WLLIFSMILFIFLLGYAWFSSHTSPLYWDCLLMRGHEITEQPMKAERAGSIMVKEAISFL
ERHSKETFLLFFSFLHVHTPLPTTDDFTGTSKHGLYGDNVEEMDSMVGLLSTNILVGDWE
LTGKILDAIDDFGLRNNTLVYFTSDHGGHLEARRGHAQLGGWNGIYKGGKGMGGWEGGIR
VPGIVRWPGKVPAGRLIKEPTSLMDILPTVASVSGGSLPQDRVIDGRDLMPLLQGNVRHS
EHEFLFHYCGSYLHAVRWIPKDDSGSVWKAHYVTPVFQPPASGGCYVTSLCRCFGEQVTY
HNPPLLFDLSRDPSESTPLTPATEPLHDFVIKKVANALKEHQETIVPVTYQLSELNQGRT
WLKPCCGVFPFCLCDKEEEVSQPRGPNEKR