GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:17:00

Sequence ARHGAP4_1 : 21267 bp : 58.40% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1243   1309   67  0  1  122  100    92 0.893  13.68
ggagcccctcgcgggcagtgccagccctgggccgccccgccccaccgggagccgcgctgg
gggcggggctgggcggagcccgcgcagggtgctggccgcagcgcccccaagtcccggcgc
cgggcccgctcacggccgcgtgggagcagtggggttcgacggcgcggccgcgaggccgcc
ATGGCCGCTCACGGGAAGCTGCGGCGGGAGCGGGGGCTGCAGGCTGAGTATGAGACGCAA
GTCAAAG
gtgagagggcgccgggcgctcccggcccgtttcctgcggagaacccaaggtcgtgaggga
gctccaagcgtccccgcgctggcccagggcccgatgctctccccagcgacctctggagcg
ggggtggaggagggagcctgagccccttgcctgcctcccgacgcccatttggcctcaacc

 1.02 Intr +   1571   1685  115  0  1   63   84    85 0.972   6.28
gcccagggcccgatgctctccccagcgacctctggagcgggggtggaggagggagcctga
gccccttgcctgcctcccgacgcccatttggcctcaaccgcctgccattttcccttcctt
ctttcctgtcttccttcctttggtctctgtcctccttgggtctaccgcttctcacccaag
GTTCAGTGGAGACACTGGTGGCCGCTGGTAAAAGAGAGCCAGATGCACCCAACGTGCCCC
TCAGAAGGCAGTATTTTAGCTACAGTGAAGTCAACCAGCTTGATTGGGCTGGGGG
gtgagtaagggagtccgggtgagtggattggtggagatcacctggccgtaaccccactgc
agtccctggagcttcagcaccttttgcctccctttagcactgagggggagcagaggcgag
ggccactgtctctgggtcaagctggcgcagtgagtcttggttgagagatttaacagggct

 1.03 Intr +   1783   1834   52  1  1   88   73    10 0.857  -0.45
agagagccagatgcacccaacgtgcccctcagaaggcagtattttagctacagtgaagtc
aaccagcttgattgggctggggggtgagtaagggagtccgggtgagtggattggtggaga
tcacctggccgtaaccccactgcagtccctggagcttcagcaccttttgcctccctttag
CACTGAGGGGGAGCAGAGGCGAGGGCCACTGTCTCTGGGTCAAGCTGGCGCA
gtgagtcttggttgagagatttaacagggctggcttctcagccttctgaaattgaacctc
tgggttctgataaacacccatgtgcaaatcacatgcaaatcagctttgcaaattcttagc
caatagcttgtgcccatcttattcagggcatggtaactcttgcaaaggaaagaggcagca

 1.04 Intr +   4230   4479  250  2  1   45   13   129 0.586  -0.65
tccaataggagatcaggggaggaggtagggatgctgggcaggcggaacccacagggtccc
catgcaacagcccctgggaagtcactggcgggacagaaatccaatgggattgagctcttc
tcagcggagtcctccctcgctgctgctggtctgaatcctgccgtcttttgcctggactag
CACAGTAGCTGCCACCTGGGCTCCACCTGGCAGTGTGAGGGGGCCCTGAAAACGAAGCTG
GACCACATCACCCCACTACTGTGGCTCCTCTCTCACTCGGAGTCCAGCTGGGAGCTCTGC
CCAGACCCCGGGCTCTGTGCCATCTGTCCCTACCGGTCTCTCGGACTCCCCCTACTGCCC
ACGTACAGCCAGCTCCAGCCTTCTGCTCCAACGATGCGGCTTGTTCTTGACCACCCTCCT
TTAAAAAGAG
gtcctccctgtccccacccacccctggctctgatcttgctttgtgggttcatcttctccg
cacccatcactcctgggcattctgatatgtgttcgtgccccattccaatcccagctccaa
gagggcagacacttggtcaaacctctttgcctttgtatttaaaacgtgcctgccacagaa

 1.05 Intr +   5637   5841  205  1  1   97   94   339 0.961  34.87
caggggcctagcttctttcctcccctcttagctcttgccctcagcctaggctgggtccga
aggagccctcagagccgacgggactggggtctgtgtgcctctgcctctcccatcccacgc
tggcctggctgacccaggcagggcgtgctgaccaggcctgagccatggttccccccacag
AGATGCGCTGGCAGCTGAGCGAGCAGCTGCGCTGCCTGGAGCTGCAGGGCGAGCTGCGGC
GGGAGTTGCTGCAGGAGCTGGCAGAGTTCATGCGGCGCCGCGCTGAGGTGGAGCTGGAAT
ACTCCCGGGGCCTGGAAAAGCTGGCCGAGCGCTTCTCCAGCCGTGGAGGCCGCCTGGGGA
GCAGCCGGGAGCACCAAAGCTTCCG
gtaggtgatgtgctggcaggggggccacggcagggcccaagctccgctcccaggtctcag
tgcccctctacccccaggaaggagccgtccctcctgtcgcccttgcactgctgggcggtg
ctgctgcagcacacgcggcagcagagccgggagagcgcggccctgagtgaggtgctggcc

 1.06 Intr +   5919   6081  163  0  1   67  100   187 0.886  18.97
ctgaggtggagctggaatactcccggggcctggaaaagctggccgagcgcttctccagcc
gtggaggccgcctggggagcagccgggagcaccaaagcttccggtaggtgatgtgctggc
aggggggccacggcagggcccaagctccgctcccaggtctcagtgcccctctacccccag
GAAGGAGCCGTCCCTCCTGTCGCCCTTGCACTGCTGGGCGGTGCTGCTGCAGCACACGCG
GCAGCAGAGCCGGGAGAGCGCGGCCCTGAGTGAGGTGCTGGCCGGGCCCCTGGCCCAGCG
CCTGAGTCACATTGCAGAGGACGTGGGGCGCCTGGTCAAGAAG
gtgaggctctcatcctgggccacgggaagtgttcgaggctttgggatcaggaggcactgt
ggctgggagggcactggaggccaggtggggagcaggcagagcgaacctgtgtgccccccc
gatggggcttgatctgggcagagcttccagtgcctggcggggccgctctgggcagtgccg

 1.07 Intr +   6287   6349   63  1  0   84   89   120 0.999  11.76
gaagtgttcgaggctttgggatcaggaggcactgtggctgggagggcactggaggccagg
tggggagcaggcagagcgaacctgtgtgcccccccgatggggcttgatctgggcagagct
tccagtgcctggcggggccgctctgggcagtgccgtgctcacccttgcctctgcctctag
AGCAGGGATCTGGAGCAGCAGCTGCAGGATGAGCTCCTGGAGGTGGTCTCAGAGCTCCAG
ACG
gtgaggaaagggctggggaggggcctgccccaatggtccagggagaaatgccactcacag
tggggaggaacaccgccagaccatcacatcaccccaagccaggctcagggagaagcacgc
acctaggggcaaaggcctctctccctaggcacagggcgttaggctaagtgctcacatggg

 1.08 Intr +   6637   6819  183  0  0  109   86   186 0.891  21.69
gggagaagcacgcacctaggggcaaaggcctctctccctaggcacagggcgttaggctaa
gtgctcacatgggatcgcccagctctgaggtccaagttccagaggggcaggggtagaggg
ctgggggctggcccagccgtggccttcaccagcaccaccttgctttgggtctccctgcag
GCCAAGAAGACGTACCAGGCATATCACATGGAGAGCGTGAATGCCGAGGCCAAGCTCCGG
GAGGCCGAGCGGCAGGAGGAGAAGCGGGCAGGCCGGAGTGTCCCCACCACCACCGCTGGT
GCCACTGAGGCAGGGCCCCTCCGCAAGAGCTCCCTCAAGAAGGGAGGGAGGCTGGTGGAG
AAG
gtgggcctggagggcacctcagacgcaggcctatgggccatgggccctaactaggacctg
ctgtgctgagggggaagtcagggctgggtgcaggggagggcaggagtggcaggacagtgc
catcaggttccagggattccatacggaaggctcccagggcctgagagagtggggaaaaca

 1.09 Intr +   8162   8290  129  1  0    8   86   208 0.888  14.67
tggcactgggctgagcacactgtggactgtggcgtggggaaggcagcaggacttctgggc
ttgaccagttcaggtgtagttgtccacagtgggaggggaggcgatgggcattacatgaaa
ggctagagataggggctggccacgtgcgtgaccctggcacgcttgcattgtcttgagtag
CGGCAGGCCAAGTTCATGGAGCACAAACTCAAGTGCACAAAGGCGCGCAACGAGTACCTG
CTTAGCCTGGCTAGTGTCAACGCTGCTGTCAGTAACTACTACCTGCATGACGTCTTGGAC
CTCATGGAC
gtgagtccttggtgggcaggtgggaaaaggtgcctggtgcctcggggctgggaagctgtg
gctccaggacctacccaagcatctccttgtttcctcctcagtgctgtgacacagggttcc
acctggccctggggcaggtgctccggagctacacggccgctgagagccgcacccaagcct

 1.10 Intr +   8392   8613  222  0  0  107   78   296 0.892  30.05
cgagtacctgcttagcctggctagtgtcaacgctgctgtcagtaactactacctgcatga
cgtcttggacctcatggacgtgagtccttggtgggcaggtgggaaaaggtgcctggtgcc
tcggggctgggaagctgtggctccaggacctacccaagcatctccttgtttcctcctcag
TGCTGTGACACAGGGTTCCACCTGGCCCTGGGGCAGGTGCTCCGGAGCTACACGGCCGCT
GAGAGCCGCACCCAAGCCTCCCAAGTGCAGGGCCTGGGCAGCCTGGAAGAAGCTGTGGAG
GCCCTGGATCCTCCAGGGGACAAAGCCAAGGTTCTCGAGGTGCATGCTACCGTCTTCTGT
CCCCCGCTGCGCTTTGACTACCACCCCCATGATGGGGATGAG
gtgagggtcaccccctgctgggcttggcattctctggccttcactgtaatggtgggcagt
ggagtggcatgacccacactttgctcaggaatccaagttctccatggtctcaggcagtgc
ggcagctagagaagtgtcccacttccatttgcagcctcactccaagggtgcacccccgca

 1.11 Intr +  12255  12353   99  2  0  113   44     9 0.570   0.47
gttcaccatttgtaagtgtgcggcccaggggcagaagcacattcacggtgctgtgcagcc
atcaccaccatccagccgcagaacttgttcatcttcccaaactgaagctctggccccgtt
caaccccaactccccaccccccagccctggcacccacccttccactgtccgtctctacag
AGTTCACGGCTCTCCTTTGAGGCCCCTCACAGGAGTGGAATCCTACAGTGCGGGCCTTTC
TGTGACTGGCTCCTTTCACTGAGTCCCATGTCCTCAAGG
gtcagccatgttggagcccatctcaaaatggccttactttctactctgtgacttgcgcct
tcatgcagtcctgtacggcggggcttggtggagatggagagcagggcaagtgtttagcca
cagctgaatcctcactctcaattttaactgtaatgtcaattttctagatgtctacatgct

 1.12 Intr +  13326  13481  156  2  0   70   11   108 0.860   2.70
atttttgtcacccctaaaggagccactactccccgttctcctctccagccccactggcac
cccactgctccagctggcacccactctgcttcctgtctctatggatttgcctggctggac
acttcacataagtggattcattccttctcgtggctgaatcctcttccattctgtgggtag
ACCGCGCTGAGTTTAGCCATCCGTCAGTTGGATGAGTGGTGCCGCCACGAACCTCTGTGG
ACAAGTCTTGGTTTGGACACGTGTGTTCACTCCTGCCATTCTTCAGCTGAGCGTCTGGGC
TGGTGGTCCTGTGCCCGGCCGCCAGGCCACAAAAGG
gtgcttgcttcccttatgccccggggatcttggcacctactgcccaagcccagcccttag
ccccctggccgccgccctctgcaggtggctgagatctgcgttgaaatggagctgcgggac
gagattctgcccagagcccagaacatccagagccgcctggaccgacagaccattgagaca

 1.13 Intr +  13566  13667  102  2  0   95   25   165 0.971  12.44
acaagtcttggtttggacacgtgtgttcactcctgccattcttcagctgagcgtctgggc
tggtggtcctgtgcccggccgccaggccacaaaagggtgcttgcttcccttatgccccgg
ggatcttggcacctactgcccaagcccagcccttagccccctggccgccgccctctgcag
GTGGCTGAGATCTGCGTTGAAATGGAGCTGCGGGACGAGATTCTGCCCAGAGCCCAGAAC
ATCCAGAGCCGCCTGGACCGACAGACCATTGAGACAGAGGAG
gtctgggcagcccaccgggggttagagggagacgagggcctggagcctgtacagcctgct
gttggaagtggctgccctgcctgcccccctccctttggccccttccttctgacttggact
tcctgtctccctccctgtcccccacctcttaccaccctggtgtggtctcctctgcaggtg

 1.14 Intr +  13845  14036  192  2  0  129   52   224 0.935  23.80
gaggtctgggcagcccaccgggggttagagggagacgagggcctggagcctgtacagcct
gctgttggaagtggctgccctgcctgcccccctccctttggccccttccttctgacttgg
acttcctgtctccctccctgtcccccacctcttaccaccctggtgtggtctcctctgcag
GTGAACAAGACTCTGAAGGCGACACTGCAGGCCCTGCTGGAGGTGGTGGCCTCGGATGAC
GGGGATGTGCTTGATTCCTTCCAGACCAGCCCCTCCACCGAGTCCCTCAAGTCCACCAGC
TCAGACCCAGGCAGCCGGCAGGCGGGCCGGAGGCGCGGCCAGCAGCAGGAGACCGAAACC
TTCTACCTCACG
gtggggagggctgggctggtgggcgggacccgtgggggcattgctggggcagagggaggg
gctcaagccagggctaacacttggggctcttcttggggctgcccagaagctccaggagta
tctgagtggacggagcatcctcgccaagctgcaggccaagcacgagaagctgcaggaggc

 1.15 Intr +  14143  14227   85  0  1   27   64   163 0.901   8.35
gctcagacccaggcagccggcaggcgggccggaggcgcggccagcagcaggagaccgaaa
ccttctacctcacggtggggagggctgggctggtgggcgggacccgtgggggcattgctg
gggcagagggaggggctcaagccagggctaacacttggggctcttcttggggctgcccag
AAGCTCCAGGAGTATCTGAGTGGACGGAGCATCCTCGCCAAGCTGCAGGCCAAGCACGAG
AAGCTGCAGGAGGCCCTTCAGCGAG
gtgggcccagtgctgcccccttccccgcctctcccctgcccaggaccctgtctagcccac
ggtcctcccctcccgcctgtccttggctcttatccacacctttctctctgggatgccttg
aagacccctggcccgagaggcagaccaatgttctcccaccccacaggtgacaaggaggag

 1.16 Intr +  14394  14421   28  1  1   85   97    44 0.960   3.30
ggcccttcagcgaggtgggcccagtgctgcccccttccccgcctctcccctgcccaggac
cctgtctagcccacggtcctcccctcccgcctgtccttggctcttatccacacctttctc
tctgggatgccttgaagacccctggcccgagaggcagaccaatgttctcccaccccacag
GTGACAAGGAGGAGCAGGAGGTGTCTTG
gtgagtcctccctgagggctggggccctgcgacggtccgccatctcttctcttcctgggg
cccagctcagctgcccaatcccctgggcctcacttccccagttttcgcactggattgtgg
aataacttcagagaattagaggccggcttggctggcctggggggtggggcaccctattct

 1.17 Intr +  14643  14745  103  0  1   83   79    64 0.929   6.34
atctcttctcttcctggggcccagctcagctgcccaatcccctgggcctcacttccccag
ttttcgcactggattgtggaataacttcagagaattagaggccggcttggctggcctggg
gggtggggcaccctattctccacacctggccccctcagagccagctcccattcactgcag
GACCCAGTACACACAGAGAAAATTCCAGAAGAGCCGCCAGCCCCGCCCCAGCTCCCAGTA
TAACCAGAGACTCTTTGGGGGAGACATGGAGAAGTTTATCCAG
gtactagctttgccccacatgccagcccacctgtacatgctgatctttcttcagctctgg
gtcacctcagtggccggagcagctgcctgatcccagggtcctccactctcaatcagtcat
caactgtccttttctgggtgggcctcttccaggccactgttgggctcccctatagcctcc

 1.18 Intr +  16256  16316   61  1  1   54  103   106 0.985   8.15
aggagtatcacttgagcccaggaagctgaggctacagtgagccgagatcacgccagtgca
cttcagcctgggtgacagagtgagaccttgtctcaaaaaaaaaaaaaaaaaaaaaaagca
attgaatgacaacacagggcatgctgtgtccatggtgaagtaaacaccctctgtccccag
AGCTCAGGCCAGCCTGTGCCCCTGGTGGTGGAGAGCTGCATTCGCTTCATCAACCTCAAT
G
gtaagcaggacccagcccctcccgatgtcctggcacccagcacccagttcccagcacctg
gcatgggaggccatcctggaggggctggggaagatgctcagtgcccaccagctccttgtc
ctcccacaggcctgcagcatgaaggcatcttccgggtatcgggtgcccagctccgggtct

 1.19 Intr +  16446  16523   78  1  0  116   59   135 0.984  14.08
agcctgtgcccctggtggtggagagctgcattcgcttcatcaacctcaatggtaagcagg
acccagcccctcccgatgtcctggcacccagcacccagttcccagcacctggcatgggag
gccatcctggaggggctggggaagatgctcagtgcccaccagctccttgtcctcccacag
GCCTGCAGCATGAAGGCATCTTCCGGGTATCGGGTGCCCAGCTCCGGGTCTCAGAGATCC
GTGATGCCTTCGAGAGAG
gtggggacgggcagggcgggcgggggtgggggctcgggcagatgtcaccagcttcctccc
cctaccgcaccactcgcccatctgcaggggaggacccactggtggagggctgcactgccc
atgacctggactcggtggccggggtgctgaagctctacttccggagcctggagcccccac

 1.20 Intr +  16611  16745  135  1  0   86   76   249 0.997  25.22
cttgtcctcccacaggcctgcagcatgaaggcatcttccgggtatcgggtgcccagctcc
gggtctcagagatccgtgatgccttcgagagaggtggggacgggcagggcgggcgggggt
gggggctcgggcagatgtcaccagcttcctccccctaccgcaccactcgcccatctgcag
GGGAGGACCCACTGGTGGAGGGCTGCACTGCCCATGACCTGGACTCGGTGGCCGGGGTGC
TGAAGCTCTACTTCCGGAGCCTGGAGCCCCCACTCTTCCCCCCAGACCTGTTCGGCGAGC
TGCTGGCTTCTTCGG
gtgaggctggggcctgaggctggcggggtagggcacttgctggggcagccccgctcacgc
ggctctctctgggcggctttggccacagagctggaggccacagcggagagggtggagcac
gtgagccgcctgctgtggcggctgcccgcgccggtgctggtggttctgcgctacctcttc

 1.21 Intr +  16834  16939  106  2  1   56   81   224 0.999  18.94
ctcggtggccggggtgctgaagctctacttccggagcctggagcccccactcttcccccc
agacctgttcggcgagctgctggcttcttcgggtgaggctggggcctgaggctggcgggg
tagggcacttgctggggcagccccgctcacgcggctctctctgggcggctttggccacag
AGCTGGAGGCCACAGCGGAGAGGGTGGAGCACGTGAGCCGCCTGCTGTGGCGGCTGCCCG
CGCCGGTGCTGGTGGTTCTGCGCTACCTCTTCACCTTCCTCAACCA
gtgagtgctgcggggcgagtgctggggtgggggccaggggtcgaggggacagggggactc
ggggtgcgggctctctgcttgtgatgtgcgtgtccccccagcctggcccagtacagcgat
gagaacatgatggacccctacaacctggccgtgtgcttcgggcccacgctgctaccggtg

 1.22 Intr +  17041  17274  234  1  0   78   38   416 0.797  33.63
agcacgtgagccgcctgctgtggcggctgcccgcgccggtgctggtggttctgcgctacc
tcttcaccttcctcaaccagtgagtgctgcggggcgagtgctggggtgggggccaggggt
cgaggggacagggggactcggggtgcgggctctctgcttgtgatgtgcgtgtccccccag
CCTGGCCCAGTACAGCGATGAGAACATGATGGACCCCTACAACCTGGCCGTGTGCTTCGG
GCCCACGCTGCTACCGGTGCCCGCTGGGCAGGACCCGGTGGCGCTGCAGGGCCGGGTGAA
CCAGCTGGTGCAGACGCTCATAGTGCAGCCCGATCGGGTCTTCCCGCCCCTGACCTCGCT
GCCTGGCCCCGTCTACGAGAAGTGCATGGCACCGCCTTCCGCCAGCTGCCTGGG
gtacacccttggtgctgccgaggggactggggggtccactggagaagagcccccctcatc
tgcctcgctctgccctgaacctcagggacgcccagctggagagcctgggggcggacaatg
agccggagctggaagccgagatgcccgcacaggaggatggtgagggcgatgggcagagag

 1.23 Intr +  17360  17433   74  2  2   71   77    64 0.973   3.80
atagtgcagcccgatcgggtcttcccgcccctgacctcgctgcctggccccgtctacgag
aagtgcatggcaccgccttccgccagctgcctggggtacacccttggtgctgccgagggg
actggggggtccactggagaagagcccccctcatctgcctcgctctgccctgaacctcag
GGACGCCCAGCTGGAGAGCCTGGGGGCGGACAATGAGCCGGAGCTGGAAGCCGAGATGCC
CGCACAGGAGGATG
gtgagggcgatgggcagagagccccaccctgtccccaccctagtgtccacaccccctccc
acagcttggaccccctctcctccccagacctggagggggtcgtggaggctgtggcctgct
ttgcctacacgggccgcacagcccaggagctgagcttccggcggggggacgtactgcggc

 1.24 Intr +  17521  17704  184  2  1  122  100   325 0.988  37.15
gctctgccctgaacctcagggacgcccagctggagagcctgggggcggacaatgagccgg
agctggaagccgagatgcccgcacaggaggatggtgagggcgatgggcagagagccccac
cctgtccccaccctagtgtccacaccccctcccacagcttggaccccctctcctccccag
ACCTGGAGGGGGTCGTGGAGGCTGTGGCCTGCTTTGCCTACACGGGCCGCACAGCCCAGG
AGCTGAGCTTCCGGCGGGGGGACGTACTGCGGCTGCACGAGAGGGCCTCGAGCGACTGGT
GGCGGGGGGAGCACAACGGCATGCGGGGCCTCATCCCCCACAAGTATATCACGCTGCCCG
CCGG
gtgagtgagccgcgccctcaggccccagggctcccggagtctccccttcatccacccctc
ccccgaccccaagttagattctgaaggtctgggctgggccagagaacagagcctctctga
ccactcctggctggcgcggagctgctggccctggaccccgtgcagggaaggagcactcga

 1.25 Intr +  17910  18002   93  0  0   61  105    64 0.978   5.64
cagggctcccggagtctccccttcatccacccctcccccgaccccaagttagattctgaa
ggtctgggctgggccagagaacagagcctctctgaccactcctggctggcgcggagctgc
tggccctggaccccgtgcagggaaggagcactcgaaacaggccggtccttcccaccgcag
GACGGAGAAGCAGGTGGTGGGCGCAGGGCTGCAGACTGCAGGGGAGTCTGGGAGCAGTCC
CGAGGGCCTCCTGGCATCGGAGCTGGTCCACCG
gtgagcaagaagacggggctcagggggccacacgtgtgctgttctaggccagaggggact
ggggtcaggctttggccagtgggagtgggaggagttggcagatgaggacgtgacagaatg
acccagcttgtgacagggagaggctctagaggagcttggggaccactgggccagcctcct

 1.26 Intr +  18276  18375  100  0  1  116  100    16 0.899   6.88
gttggcagatgaggacgtgacagaatgacccagcttgtgacagggagaggctctagagga
gcttggggaccactgggccagcctcctttccttggccacaccccaggatgggaggagcca
ctgcccagctagctcagggacttcccagggcccccaccaggctccctgtctgtcctgcag
GCCAGAGCCATGCACCTCACCTGAGGCCATGGGACCCTCTGGACACAGACGACGCTGCTT
GGTCCCAGCCTCCCCAGAGCAACACGTGGAGGTGGATAAG
gtgagagtgggtgtgtggcaggtgagggacatctgtcctgggggatctctgcctcccctt
ggaagccaaactcctccctcctcgaggttccagtcgttgccctccctggccttagctcaa
gggaacctgccgccagacacacaggcccaaggcagagcctgtggagggcaggaaggcaaa

 1.27 Term +  19483  19716  234  0  0  105   51    45 0.652  -0.19
gacaccaacagggacaggagggatgccaggtgcaaagtgggggagagtgacctggaggct
gagggactggggatgttggctgagggcttgctttgggagtgggaggaactcaggtgggtc
ttgggcagggtcagtcgggggaactcactggtcactctccctttctttcccctccgctag
GCTGTGGCACAGAACATGGACTCTGTGTTTAAGGAGCTCTTGGGAAAGACCTCTGTCCGC
CAGGGCCTTGGGCCAGCATCTACCACCTCTCCCAGTCCTGGGCCCCGAAGCCCAAAGGCC
CCGCCCAGCAGCCGCCTGGGCAGGAACAAAGGCTTCTCCCGGGGCCCTGGGGCCCCAGCC
TCACCCTCAGCTTCCCACCCCCAGGGCCTAGACACGACCCCCAAGCCACACTGA
ggtgccgctgctggagatgcgtgcccccggcggctacccgctggaccggccactctcccc
agcccccttgcttctctccagccctgtccagcaagtgcagggtgcctgcacttcaccctg
tgcagagaggtgggatggggccgtgcacacagggatgcccgctccacatcctgcctgccc

 2.03 PlyA -  20305  20300    6                               1.05
 2.02 Term -  20922  20717  206  1  2   86   55   181 0.999  13.11
 2.01 Init -  21125  21029   97  2  1   77   98   107 0.645  11.11

Predicted peptide sequence(s):


>ARHGAP4_1|GENSCAN_predicted_peptide_1|1170_aa
MAAHGKLRRERGLQAEYETQVKGSVETLVAAGKREPDAPNVPLRRQYFSYSEVNQLDWAG
GTEGEQRRGPLSLGQAGAHSSCHLGSTWQCEGALKTKLDHITPLLWLLSHSESSWELCPD
PGLCAICPYRSLGLPLLPTYSQLQPSAPTMRLVLDHPPLKREMRWQLSEQLRCLELQGEL
RRELLQELAEFMRRRAEVELEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLH
CWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVV
SELQTAKKTYQAYHMESVNAEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKG
GRLVEKRQAKFMEHKLKCTKARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALG
QVLRSYTAAESRTQASQVQGLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHD
GDESSRLSFEAPHRSGILQCGPFCDWLLSLSPMSSRTALSLAIRQLDEWCRHEPLWTSLG
LDTCVHSCHSSAERLGWWSCARPPGHKRVAEICVEMELRDEILPRAQNIQSRLDRQTIET
EEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQET
ETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYTQRKFQKSRQPRP
SSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGIFRVSGAQLRVSEIRD
AFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGELLASSELEATAERVEH
VSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVAL
QGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEA
EMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIP
HKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCL
VPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLG
RNKGFSRGPGAPASPSASHPQGLDTTPKPH

>ARHGAP4_1|GENSCAN_predicted_peptide_2|100_aa
MTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSS
VSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS