GENSCAN 1.0	Date run: 17-Jan-104	Time: 05:15:00

Sequence AMOT_1 : 68712 bp : 42.26% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1320   1642  323  1  2   94   69   128 0.276   6.15
ccgctcaccgcaagaagaaaagccacccgttcgtccccctcccctacctcccatcctttg
cccaggagctgccttggcagtcacgccccttccttccgaggagctttctggctgcctaaa
ctggtagaccccctgaattactcctccatctccgctctctttcgcctcctcttctcttag
TTCTCTCCGCCTCCCCCTCAACTACCACCACCTCCAGTCAGTCTCGCCTCCGGCTATCCG
CTGCTCCACCCTCTGGCCCGGTATCCTGCCTGTCCGCTGCCACCAAGGAGAGCCCGGACG
GAGCAGCGAGGAGGGGAGCAGCCGGGAGTTGGGGCTTCCCCCCTGCCCATCCCTGGCCGC
TGGCCCGGGACCGAAGCCACTTGAGCGAGCAGAGAGTCGTCACCTTGTCTTCTTTGCCTT
CAGGGGTAGGAGACGCGTGGTTACTTTTCGCGGGGAACTGGGGCAGGAATCCATGGTGGC
ATGAACTTGGTCGTGCCCTCGGC
gtgagtgaatcgatctaggcgcgtgtgggaatgcccgtgtgttctactttctttgcagct
cgccatgagtttttttggatgtgcagcaagttaaatcggttagagtgtgcgctgctttcc
cgtcctacttcggtgaggagatgctagtgggtaccactactagatggtacttttacttct

 1.02 Term +   7699   7935  237  0  0   82   48   141 0.232   4.68
gtggagagtctcccttcttcttattggtgtcacatcagatcacaataactgtgccgcccc
cctatcaaccttaggcattgatactgatctttttttccccttatatataccccatagcaa
acttcacatttcaatctttttgatatggacaaacgatctgctctcctctttataatgcag
ATAAAACTGATGTATGTGTTTTTTAAGAGCATATTTTCCCTGCACATGCTTCTCATTATC
CGAGAGGCCTGGACTCAATCAGTAAAGGAGCAGAGAAACCACATAATTGAAAGGAGAATG
ACGGTGGTGCATACTTGGAATATTTGTGGGAAGGGGATTGCTGACATCAGAAAATGTAGT
GGCCTGAGTGTTAACAGCATTGAAGAGAAATCAGCTTTCTGTGTTTCTGTGTATTGA
aaattatttttaagggaataaaaatatgggccaggtttgacatccttttatgaagttgcc
ctggaaactttgatgaagattgttaaagaatagctcaattaaaaccttccccattaggaa
gctaattagtacatcccttactcattttggttgttttcaaggggcatgtatttgcattga

 2.01 Init +  12240  12493  254  2  2   53   53   125 0.319   2.36
gactctttatacttttctcgagataataaagaaggggatgtgatggtgtggtctactcct
cttttggaatggatgtgtgtgctgggagatagagggaggtggcaacaggattctccttgc
tacccagtatgtcactgctcacatccacttcagggttgatcacctttgttgcctataaac
ATGTTTAAGGTAATTGCTTCAGAGCAAAGCAAAGTCAAACTGGGACCAAAAACGACCAAG
ACCTTGAGTTACCATCCCAGAAACGGATCTCTCACACTGATCCTCAGTAAGATTTGGAAA
TGCCAAGGCCTTGCTGTGGTTCTTAAAATAATTTTTCAACCTAATCTAATAGGGTGTTCA
AAAATAATTGTGATGTTTGCAATAGAGTGTATTAAGCTGTCCTTGCATTGCTATAAAGAA
GTACCGGAGACAGG
gtaatttataaagaaaagagttttaatgggctcacagttctgcaggctttatgggaagca
tggtgcgaacatctacttggctttggggcgggggcctcaggaagcttgcaatcatggcag
aaggcgatgggggagcaggcacatcacatggcaaaagcgagagcaagagacaacggggga

 2.02 Intr +  17356  17428   73  1  1   50   69   124 0.559   5.19
ggaaaagtaatttggtagtcatctctctagttttgggcaccaaaaaggatttatatatta
tgcttgtcagcctatcagaatatcccaatttgacagttcaagtacaggagtcctggaggc
acattgggaggaatggaaaagggactgggttgcttaacccactggtgtgcacttcccaag
AGAATATGATGAGAGGGACTTTGGAGGGTCCCTTCGTGTTGTCAGACTGCCCAGCGCAAC
AGTTGGAAGCCAG
gtagcagtaaccaacaagacgtgaagaaagagagaagatgaactttcttcatatactata
tgtacattctgggtcactctctctctgcatgaccaaaagaaaggggttcgtgtttccaga
gagattgcaggccacttaatatcatagaaataagagcctgggagccagggatccagagtt

 2.03 Intr +  18872  19761  890  1  2   68  110  1004 0.566  89.78
atctattaattttagagtcaattctctactttgtttctgcaatcgaatcctcaccctcca
atatccattttctttccctttagaggactgatttatccatcaactgggtgttaagcttcc
tgtttccccttcccaggtcaagggcagcccaggtgcccaatttctctctctcttcacaag
GCACCACCAGCAATAGAGATGAGAAATTCTGAAGAACAGCCAAGTGGAGGGACCACGGTA
TTGCAGCGTTTGCTACAAGAGCAGCTTCGCTATGGCAATCCTAGTGAGAATCGCAGCCTG
CTTGCCATACACCAGCAAGCCACAGGGAATGGCCCTCCTTTCCCCAGTGGCAGTGGGAAC
CCGGGCCCTCAGAGTGATGTGTTGAGTCCCCAAGACCACCACCAACAGCTTGTGGCTCAT
GCTGCTCGACAAGAACCCCAGGGGCAGGAAATCCAGTCAGAAAACCTCATCATGGAGAAG
CAGCTGTCTCCTCGAATGCAAAATAATGAAGAACTCCCGACCTATGAAGAAGCCAAGGTC
CAGTCCCAGTACTTTCGGGGCCAACAGCATGCCAGTGTTGGAGCTGCCTTCTATGTCACT
GGAGTCACCAACCAGAAGATGAGGACTGAGGGACGCCCATCAGTTCAGCGGCTCAATCCT
GGAAAGATGCACCAAGATGAGGGACTCAGAGACCTTAAGCAAGGGCATGTCCGTTCCTTG
AGTGAACGACTAATGCAGATGTCACTGGCCACCAGTGGAGTTAAGGCCCATCCACCTGTT
ACCAGTGCTCCCCTCTCCCCACCACAACCCAATGACCTCTACAAGAATCCCACAAGTTCC
AGTGAATTCTACAAGGCCCAAGGGCCACTTCCTAACCAGCATAGCCTGAAGGGCATGGAA
CACCGAGGCCCCCCACCAGAATATCCCTTCAAGGGCATGCCACCCCAATCTGTAGTGTGC
AAGCCCCAAGAGCCAGGGCACTTCTATAGTGAGCATCGCCTGAACCAGCCAGGGAGAACA
GAGGGGCAACTGATGAGGTATCAGCATCCCCCTGAGTATGGAGCAGCCAG
gtaagagagttctgtttctgtcatttcctgacctcatccccaaccagcttctgctgtgtg
ttgggaatcttagggaaggaacgggcaggtgtttgatataacaaactctgcaatgcatga
caggcctctggcttcgtgaattgcctgccaacccgaatttgtatcctctttagccataat

 2.04 Intr +  26139  26658  520  0  1  110  100   481 0.823  43.53
gtggtctttgcagagatagagcaggcagggttagacttccccatagtcagaccctgcctg
ctcttcattttgcaggtgtcctgggggcatcagaagcctcctcatctcacttttgtgtgc
ccttctcccccagtgccttaggagagaaattaacccgcacctgcccttcatgttttacag
GCCAGCGCAGGACATCTCATTGCCATTGTCAGCCAGGAACTCGCAGCCTCACAGCCCTAC
TTCTTCTCTGACCTCTGGGGGGTCCTTGCCCTTGCTACAATCTCCACCATCCACTAGATT
GTCTCCTGCCCGACACCCCTTGGTCCCAAACCAGGGAGACCATTCAGCTCACCTGCCTAG
GCCGCAGCAGCATTTCCTTCCTAATCAGGCTCACCAGGGGGATCATTACCGTCTCTCCCA
ACCTGGCCTGAGTCAGCAGCAGCAGCAACAGCAGCAGCAGCACCATCATCACCATCACCA
CCAACAACAGCAGCAGCAGCAGCCACAGCAGCAGCCAGGAGAAGCCTATTCAGCTATGCC
TCGGGCTCAGCCATCCTCTGCTTCTTATCAGCCAGTGCCAGCAGACCCTTTTGCCATTGT
TTCCAGAGCCCAGCAGATGGTTGAGATCCTCTCAGACGAGAACCGGAACTTGAGGCAAGA
GTTGGAAGGATGCTATGAGAAGGTGGCAAGACTGCAGAAG
gtgaggcttccgttttgggatattagggtctctaagtctttatttgtgagacttgtttaa
tatccacattaaagtctccagttgtgaatcccagcattacttgtggcaggtcttcaggat
ttttatatctgaaggttagatatgagtcaaactttggaaaaagccttctacctgtctacc

 2.05 Intr +  30623  30767  145  1  1   87   78   139 0.810  11.73
ttatggttgaaggtggagatcctttcttgaaacttgtgtcatctgactgtgttatgcttg
cctcctggccatctgtgagccctgggagaagctgtcagcgaggatttgcctgtttgtttt
cagaccattttccccatcaccctcctaccatcaccaccattgtctttttttgttgttaag
GTGGAGACAGAAATCCAGCGCGTCTCGGAGGCATATGAGAACCTCGTGAAGTCATCCTCC
AAAAGAGAGGCCCTAGAGAAAGCCATGAGAAACAAGCTAGAGGGCGAGATTCGGAGGATG
CATGATTTCAACAGGGATCTGAGAG
gtgagggaaccaacagacttgtctttgtacttctgaagcagctgcagggtggtgaaggga
agggctgagcaggatccaactaggctctttggggttgtccaacccaccggtatgggcagt
aaatggctgggcatgtgccaggctaattttttgtgactgcaatagtcctcagtcccaagc

 2.06 Intr +  32030  32122   93  0  0   72  106   147 0.887  13.92
tccccggccatggtctagtattattttgggattcacatttgcaaactcatgttagtcacc
cattcctgtttaacaagaagaaacaggcttgttttaccaaaggtcagtatttagagggcc
aatagtatgtgcatgaaagtttacatttgagaccctgttgattgtctccaaatttcacag
AGCGTCTAGAGACTGCCAACAAGCAGCTTGCAGAGAAGGAATATGAGGGGTCAGAGGACA
CCAGAAAAACCATCTCGCAGCTCTTTGCAAAAA
gtaagtctgcaagctgcagaaacaggtattaacgtgtggatgggagcaaggtgcgtgaaa
agattacactgttctctttagccttttagaacagccagggcagagtcaatatcacctaag
gattgtttttcctattcaggcatgaagttggaagattctgttcttttcctcctaagccaa

 2.07 Intr +  36924  37084  161  1  2   61   69   289 0.541  23.09
atttctacaacaagttagtgagagagccagtgatagagtccagatcttgggtatactggt
tcttcagctgtgcactagagcagtaggctatctagtaaagggtatgatgtgtcaattttg
ctcaggtaaggctttgagctagctccaggctggcagtgttgatgtttaatgtcctgacag
ATAAAGAAAGCCAGCGTGAGAAGGAGAAGCTGGAAGCGGAGCTGGCCACTGCCCGTTCTA
CCAATGAGGACCAAAGACGACACATCGAAATCCGAGATCAGGCCCTGAGTAATGCCCAGG
CCAAGGTGGTAAAGCTGGAAGAAGAGGTATGGTTTCCTCAG
gtagcatatgagcctgggggtgggagggctgggaaatcggggacactgggctccacattg
tggtgaattggcagctgcataatccccagaagggaggtgccatctgctgctcctagtttc
cactgtgctgatgtgagtggactttgctttcttttctcttcttggtaaattcttttcttt

 2.08 Term +  40777  40920  144  0  0   47   32   146 0.286   1.83
accagcgtgtaccctgtgcccctattgcagtagcagccgaacgaggtaaatggtgccttt
ccgtccttgcccttatctttctttcgggacacgtaggtcctattgaagtggaggctcatt
aaactccaagtcaaaagagctctgtgtcctacagcaaccacggtattctcccattcaaag
ACAGCCTCCCCACCCCCTACCAATTTGACCTCGCTGGAGATTTTCGATGGATGTCTGGCA
TATCCTCTCACAAGGCTCAGGGCAGCCCAGGCTTCTGGCTGGCTGCTGTCTTATGATGAT
CCGGAGTGGAAGCGGCTTGGGTAA
ttgtttcagggatggtgggaaaaaggccttggcaagatcaaagagggaagatgctgcggg
tgggctgcttactgaactgagtgcacaggaagggagagtgtggaatgtgagagggctggc
agagagagccagtgagccttgttctttggctttaggctagaatgaaagccatggagattc

 3.01 Init +  50023  50184  162  0  0  101   80   262 0.999  26.48
tctctttatgagcaatacaaggcagcctgctactcattgtgaaggaccttctcgccatcc
attcctttttgcagctggactctaaaacaagaagagatctaaacacaaggctggatttag
gggatacataattgaccctgttgcttgctgtttttcctttcaccttgcaaattacccaac
ATGGATTTCCAGCTGAAAAAGAAGCAAGTGTACGTTGACAAGGTGGAGAAGATGCAGCAG
GCCCTTGTACAGCTCCAGGCAGCATGTGAAAAACGTGAGCAGCTAGAGCACCGTCTCCGG
ACACGACTGGAGAGGGAACTGGAATCCCTGAGAATCCAGCAG
gtatggagaacttaaaggaagaaagggaaaaaaaagtaagaaaatgacattattcctggt
tgcttatttttcagttagcatttgacatgaacactgaaagcacacacttgctcattttta
catttttctcccacctaatcttactccagagtgcctcccaattgtgaatacaaagtctgt

 3.02 Intr +  51234  51424  191  2  2   71  107   229 0.982  20.56
attcaagcccatgataggaagtcctgtggccctgggaggagatctgaattccccctgctt
ctttctgaatcagagtcgaaacagaagtaggctgggcagtaatcctctccaagaataggg
gctcagacaccatggttcttctctcactaacttgagggttctctgcatctgccccaacag
CGTCAGGGCAACTGTCAGCCCACCAACGTTTCAGAATACAATGCTGCTGCACTGATGGAG
CTCCTTCGGGAGAAAGAGGAGAGGATTCTGGCTCTGGAAGCTGATATGACAAAGTGGGAG
CAGAAATATTTGGAGGAGAATGTGATGAGACATTTTGCTCTGGATGCTGCTGCAACTGTG
GCTGCTCAGAG
gtaagtaggtagctggtagggcatgagtgggaagaacagaaaggtcactgattcatagat
ttttccagtgttttattttctttaatattctgggtttcccccccaatttctgcctaagtg
tgttttctttcatctgattatgcagggaatgaacggctgtagagacagagggtcagggat

 3.03 Intr +  51908  51976   69  2  0   38   95    86 0.758   1.68
ctttcagccacatatgcaggttgtttagccccaggaccggagtgaaagcccctccagaga
aactaccactcagaaactaaatgtcactgaggagttgctgctgtcatttgatagctctgg
cttgtccaaggtatgtcaaaggctgtgctgaacttgaacccatccctgccctttgggaag
GTCAATATTTGAAGGCCACATTCTCTATGTGCATAACCTCATCGTGCGTGAGCGGTCACA
TTTCATCTG
gtaagggagagaaagtggctggaggatttttactttttgctccttatttgttcccctttt
caaattataaaagtcaattattggcctttggaggaaatagttgctcttacctcatgtgtc
ttaccttgctgctgctcaaaatcatcagttggggtaaaaagaaaggaagaaagagaaaga

 3.04 Intr +  59354  59476  123  2  0  111   98   147 0.999  16.78
gaacgctgaactgtcctattttggaggctcttacgggttagttccccagaaaccatctgt
tccaaatgtgcttgatttcagcttaggactttccagaaaagccttccttgacttagaaga
aagataacattcattgatcttgctatgctcccatctcatcacttccattttcctccccag
GGACACAACAGTCATCAGTCACTCTCCTAACACCAGCTATGACACAGCTCTAGAAGCTCG
CATCCAGAAAGAGGAGGAAGAAATCTTGATGGCCAATAAGCGTTGCCTTGACATGGAGGG
CAG
gtaaaatgttgttctggaccctgaggaatctgagacattgatatagagaccacataggat
ctttattcacagctaggaaatctgatcatgcagcctccccgctccaccatcacccctgcc
agcctgtcacttaaaggtgtgagatgcaatgacctttaccttgataatctccactaaaca

 3.05 Intr +  60898  61130  233  1  2   78   63   205 0.996  13.49
ccagctaatttttgtgtttttagtagagacagggtttcaccatgttggccaggctggtct
cgaactcctgactttgcaatccgcccacctcggcctcccaaaatgctgggattacaggcg
taagccaccgcgcccagcccacaacaaggtctttatatgttctttgcctttggctcctag
GATTAAGACCCTCCATGCCCAGATTATTGAGAAGGATGCCATGATCAAAGTACTCCAGCA
GCGTTCCCGGAAGGAGCCGAGCAAGACAGAGCAGCTGTCGTGCATGCGGCCAGCGAAGTC
TCTGATGTCCATTTCCAATGCTGGATCAGGCTTGCTCTCCCACTCATCCACCCTGACTGG
CTCCCCCATCATGGAAGAAAAGCGAGACGACAAGAGCTGGAAGGGGAGCCTAG
gtaatgacagtaaataaggaagattatagtcacgtgttcaaagagagccctgagataagc
acccatgcttaaggaaaagggatgatggtccaggttctagagaggaaggtgtaccagggt
tttggagtttttttttcctcctgagaccctagttccacattctggagctcctccacactt

 3.06 Intr +  62336  63019  684  0  0   97   91   634 0.972  55.21
cttagactattctaaattatttaatatttaaaaataataatattttaaatatttaaataa
tatttacttatttaaaaataaataaatttcttctgaaatttgaatgggagaacaggtaat
tagatgtctggatttgaatcacctattgttttctaacatctgttcctctttcatttgtag
GCATTCTCCTGGGTGGAGACTACCGTGCTGAATATGTCCCTTCCACACCCTCGCCTGTGC
CACCCTCGACTCCCCTGCTCTCGGCTCACTCCAAGACAGGCAGCCGAGACTGCAGTACCC
AAACTGAACGTGGGACGGAATCGAACAAAACTGCAGCTGTTGCTCCCATCTCTGTTCCTG
CTCCAGTTGCTGCTGCCGCCACTGCTGCCGCCATCACTGCCACTGCTGCCACCATCACCA
CCACCATGGTAGCTGCTGCTCCAGTTGCTGTTGCTGCTGCTGCTGCTCCAGCTGCTGCTG
CTGCCCCGTCTCCAGCCACTGCCGCTGCTACTGCTGCTGCTGTTTCTCCAGCTGCTGCTG
GTCAGATTCCAGCTGCTGCCTCTGTTGCCTCAGCTGCTGCCGTTGCTCCTTCTGCTGCTG
CTGCTGCTGCTGTTCAGGTTGCTCCAGCTGCTCCGGCTCCAGTTCCAGCTCCGGCTCTGG
TTCCGGTTCCAGCTCCAGCAGCGGCTCAGGCTTCTGCTCCTGCTCAGACTCAGGCACCAA
CTTCAGCTCCGGCTGTGGCTCCAACTCCAGCTCCAACTCCAACTCCAGCTGTGGCTCAGG
CTGAGGTTCCTGCAAGTCCAGCTACCGGTCCTGGACCACATCGTTTGTCTATACCAAGTT
TGACCTGCAATCCAGACAAAACAG
gtaattattccctttagcaggtaggttttggtttagttctgctctcaaatacagatttat
ttcttgttgtctgatgtctgggcagagttatcatttggactgagtttttcacgttctaaa
ggagagagaagagagtctgtaaatgacttctcatccaccaagatgggaacaggcatgagt

 3.07 Term +  63352  63449   98  2  2   80   41    96 0.890   1.25
atccaccaagatgggaacaggcatgagtagaggccattatcttagcagaagtaaatgagg
gaggtggcaggcaagtctcactttgccattggcttcatgagggctctgatggtgtctggt
tctagaaatatgggttttttcttcatccctaagtgttttctaacccttatttccatttag
ATGGGCCTGTGTTCCACTCCAATACTCTGGAAAGAAAAACTCCCATTCAGATCCTGGGAC
AAGAGCCTGATGCAGAGATGGTGGAATATCTCATCTAA
acggccaaatcaagagctgcagattatcagcaaaaatgcttttaatcattttcccccttt
tattggttcttgttttgagggtgaggacaagggttgtggggaggggatgttttttaacag
gactttttattggaacaatgtactacttgagtaataccatgtgaacaccagtctattttg

Predicted peptide sequence(s):


>AMOT_1|GENSCAN_predicted_peptide_1|186_aa
XLSASPSTTTTSSQSRLRLSAAPPSGPVSCLSAATKESPDGAARRGAAGSWGFPPAHPWP
LARDRSHLSEQRVVTLSSLPSGVGDAWLLFAGNWGRNPWWHELGRALGIKLMYVFFKSIF
SLHMLLIIREAWTQSVKEQRNHIIERRMTVVHTWNICGKGIADIRKCSGLSVNSIEEKSA
FCVSVY

>AMOT_1|GENSCAN_predicted_peptide_2|759_aa
MFKVIASEQSKVKLGPKTTKTLSYHPRNGSLTLILSKIWKCQGLAVVLKIIFQPNLIGCS
KIIVMFAIECIKLSLHCYKEVPETGEYDERDFGGSLRVVRLPSATVGSQAPPAIEMRNSE
EQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQ
DHHQQLVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHA
SVGAAFYVTGVTNQKMRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLAT
SGVKAHPPVTSAPLSPPQPNDLYKNPTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFK
GMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNS
QPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLPRPQQHFLPNQAHQGD
HYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASYQPVPA
DPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSK
REALEKAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNK
ESQREKEKLEAELATARSTNEDQRRHIEIRDQALSNAQAKVVKLEEEVWFPQTASPPPTN
LTSLEIFDGCLAYPLTRLRAAQASGWLLSYDDPEWKRLG

>AMOT_1|GENSCAN_predicted_peptide_3|519_aa
MDFQLKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQ
PTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRSI
FEGHILYVHNLIVRERSHFIWDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDME
GRIKTLHAQIIEKDAMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTL
TGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQ
TERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAAAPVAVAAAAAPAAAA
APSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVPAPALV
PVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSL
TCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI