GENSCAN 1.0	Date run: 17-Jan-104	Time: 02:22:37

Sequence TRAF1_1 : 24599 bp : 49.27% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1541   1666  126  1  0   74   40    83 0.687   2.98
aggacccaaaggagcccagggctctctgctgtgcaggctgtctctctgagaacccgaggt
gaggtgatggaggagcggagggtgggcagaaagtgggtgccagggagggacccctgatgg
gaggtgaggggcagaggagcctgtgacttcaggcggtgacttttcttctctgggcctcag
TTTCCACACCCTTTTCTCACACTCCCTGACACTGCCCCTCTGGCTGTGGTGGAAGGAGAG
GAAGCCACAGAAAGGCATCAGCTCCCACAGGGGAAAGCCATCCACACCGAGGAGAGCCTC
GAGGCT
gtgaggccactgtctcactgtgtggtctggtgctctgctaatgtccctaagccgcagctc
gcttgtctgtaaagctgttttctgtgtcatagaattgttaatgaagcccaatgaataata
atcacaaaagtccttataataacaaatataaacctcttggtgaatgacaaactgttagac

 1.02 Intr +   2210   2324  115  1  1   97   34    82 0.346   3.72
gtgtgccaaatgctctgcccttgggtcctcagcacaacttagaggggtggatactattat
gatcctattttacaaatgagaacactgaggcctaacagattaggtcagctttggtcagtt
tcctggcaaatatgcccttaaactatctcatgtgatgaccttttgtttgcggttttacag
CTTAAGAAGGTGGCAAAGCTGAATCAGGCAAGTGAGAAGTTCAAACATGACGACAAAGGA
GGAGGCTGTGAGAATAGCGAGGAGAGGCTGTGGCCGTGGAAAGGCCAGCCAGGAG
gtggaggagcagaggttcactggttttaccatcaagcggattgtcagggttcagctcagg
ctctggtagtgggtctcctggtttcccctctccctccttccaaaacctggcagaggaggg
agctgattggaagttggagggctgaggcctgaggcctaagtcctgaagagcttctactca

 1.03 Intr +  13100  13119   20  0  2   81  121    13 0.248   0.23
aaagggaacagcagtgtgcaaagtcatgtggcccaagccatctcctgccctggtggatcc
tggtgcattgaagagagccccagggtagccacagggatcgctataacattcagtgatgtg
attattatttccaggctcaccccgaggtggctgaggctggaattgggtgcccctttgcag
GTGTCGGCTGCTCCTTCAAG
gtaagcatctgagtgtgagaaaggagatctatccactatggttccagacctccaggtctc
cccactgcagcccctccatgattttcccgtaacatcagtccactcatctggatgtccttt
gtactaatgactttcccaagcatcagagcctactattaagtcatcacagtactcagggaa

 1.04 Intr +  13616  14026  411  1  0   78   96   558 0.730  49.98
tcatcgtgggcatgtctgatgccagggtcttcctctgaatccctcccactgtacagaaag
ccactcctttttgctgggtgaatgaataatccttggtgacctttgatagcagggcactcc
actgctcccctgtcctcactccacctctgttttcactgatcagccccactctcttgtcag
GGAAGCCCACAGTCTGTGCAAGAGCATGAGGTCACCTCCCAGACCTCCCACCTAAACCTG
CTGTTGGGGTTCATGAAACAGTGGAAGGCCCGGCTGGGCTGTGGCCTGGAGTCTGGGCCC
ATGGCCCTGGAGCAGAACCTGTCAGACCTGCAGCTGCAGGCAGCCGTGGAAGTGGCGGGG
GACCTGGAGGTCGATTGCTACCGGGCACCCTGCTCCGAGAGCCAGGAGGAGCTGGCCCTG
CAGCACTTCATGAAGGAGAAGCTTCTGGCTGAGCTGGAGGGGAAGCTGCGTGTGTTTGAG
AACATTGTTGCTGTCCTCAACAAGGAGGTGGAGGCCTCCCACCTGGCCCTGGCCACCTCT
ATCCACCAGAGCCAGCTGGACCGTGAGCGCATCCTGAGCTTGGAGCAGAGG
gtgagtgtgggaggcaggtttgccttcaagcccggctgagccccatcctgtctccagagc
ggcagacaggcttcctcctaatcattcatcctgcttacagcagtcactccatcaaaacgt
atctcccctttatcccacacccttccaggaagagcgctgagttagaagctgtagtcaagg

 1.05 Intr +  15841  16018  178  0  1   78   92   224 0.990  21.29
cctggtggataaggaaaaggaaggccaggcagggggcagcacattcagatgcagacgcac
acctgagtgaggcgtggtcagcaaaacacatctggggcagatcaatctccacatcccgcc
attcccatcccatccccaagccgggttctggtgttcctggctgaacagtcttccctacag
GTGGTGGAGCTTCAGCAGACCCTGGCCCAGAAAGACCAGGCCCTGGGCAAGCTGGAGCAG
AGCTTGCGCCTCATGGAGGAGGCCTCCTTCGATGGCACTTTCCTGTGGAAGATCACCAAT
GTCACCAGGCGGTGCCATGAGTCGGCCTGTGGCAGGACCGTCAGCCTCTTCTCCCCAG
gtaacacctcccaggggcacagagacctgcctggggaaacaggccccacaggacccagga
agcaagcagtgaaaactgccagctctgtgacagacacgctgtgtccagtttaggccagtg
cccattcaggccactcaccatgggcaggaaccatgctgggatcttcaggttggtgggtga

 1.06 Intr +  17976  18124  149  1  2   80   86   277 0.967  26.65
agctagatgacccccaagagcccattcctgtctgacaccctactcgagaagaatgctggg
ttctaaccccatctttcatggttttgagccgctgaccttgggcatgcctgaccactggat
cccagtcccacatctgcaaagtccagcacttcccaactgcctctggcttctgcgtttcag
CCTTCTACACTGCCAAGTATGGCTACAAGTTGTGCCTGCGGCTGTACCTGAATGGAGATG
GCACTGGAAAGAGAACCCATCTGTCGCTCTTCATCGTGATCATGAGAGGGGAGTATGATG
CGCTGCTGCCGTGGCCCTTCCGGAACAAG
gtatgggtgtgaaggtgatgggggtaaggtggggagcatggaagcctgagtcctagtcct
ggtttggcaatgaattggccatgtgacctggcaagtcccccaccctctctgtgttatcag
tttccctttttataaaacaatcagatctagtaactagggctccctccagctccatgagtc

 1.07 Intr +  21696  21917  222  2  0   84   55    83 0.793   2.92
gatggacatttcaggggcatgtgccagggaagagggtttgtgtcacttttagacaatcgg
cttctcaggggaacctccgtctgtgctgtgtataccagaagctccacaaatgtctcagga
catcgatgacagcccctcagtagaagacctctctgttctggcccttctgccttgccccag
GAGGTTCCAGCTGTAGTTGATGAAGCAAAACTTTCCAAGCCAGAGGGGGTGTTACAGGTT
ATTGCCTCCACCCACCTTGTCAGTGCTTCAGTCACACCCTCTGCCCCCAACAGCCAGTCA
CACTTGACTGGGGCATCAGAACCTTCCCCTGCTTCCTGCTGGCTGGAGGGAACATCTGAT
CCTCATCATGGAACAGCCCCTGAAGTGCACTCAGAATACCAG
gtgccgctggctccctgggtctggccatacgccaggtgcgctccttacttggtttctctg
actcctaatccaaatgagccaagggtctgaggggctgcacaggcagtaggtgtggagcac
agctctgagcccaagcctgggcctccaagctgcgctgctgctgtagggcctgatctccca

 1.08 Term +  22116  22334  219  2  0  125   46   315 0.998  28.04
gtctggccatacgccaggtgcgctccttacttggtttctctgactcctaatccaaatgag
ccaagggtctgaggggctgcacaggcagtaggtgtggagcacagctctgagcccaagcct
gggcctccaagctgcgctgctgctgtagggcctgatctcccacctatcccttccctgcag
GTCACCTTCATGCTGCTGGACCAGAACAACCGTGAGCACGCCATTGACGCCTTCCGGCCT
GACCTAAGCTCAGCGTCCTTCCAGAGGCCCCAGAGTGAAACCAACGTGGCCAGTGGATGC
CCACTCTTCTTCCCCCTCAGCAAACTGCAGTCACCCAAGCACGCCTACGTGAAGGACGAC
ACAATGTTCCTCAAGTGCATTGTGGAGACCAGCACTTAG
ggtgggcggggctcctgagggagctccaactcagaagggagctagccagaggactgtgat
gccctgcccttggcacccaagacctcagggcacaaagatgggtgaaggctggcatgatcc
aagcaagactgaggggtcgacttcgggctggccatctggttaggatggcaggacgtgggc

Predicted peptide sequence(s):


>TRAF1_1|GENSCAN_predicted_peptide_1|479_aa
FPHPFLTLPDTAPLAVVEGEEATERHQLPQGKAIHTEESLEALKKVAKLNQASEKFKHDD
KGGGCENSEERLWPWKGQPGGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLG
CGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELE
GKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALG
KLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYL
NGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKEVPAVVDEAKLSKPEGVLQVIASTHLV
SASVTPSAPNSQSHLTGASEPSPASCWLEGTSDPHHGTAPEVHSEYQVTFMLLDQNNREH
AIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST