GENSCAN 1.0	Date run: 17-Jan-104	Time: 02:38:33

Sequence SLC27A4_1 : 19758 bp : 54.18% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1361  161  0  2   90   70   226 0.920  18.33
cccttccaggccaagcctggaaagggacccctgtggtcagtcacccaactcagtatggct
aagccttaccacaggctgtccccttgggatcacagtggcctggctgtctgggctgggagg
taggagacctggagggttgggtgtttgggtccactaactgccctgtgtccgcaggccaca
ATGCTGCTTGGAGCCTCTCTGGTGGGGGTGCTGCTGTTCTCCAAGCTGGTGCTGAAACTG
CCCTGGACCCAGGTGGGATTCTCCCTGTTGTTCCTCTACTTGGGATCTGGCGGCTGGCGC
TTCATCCGGGTCTTCATCAAGACCATCAGGCGCGATATCTT
gtgagtacctggcccagcctttcctggggtctgccacactacagtgagcttctggtcccc
caaatctccccaggccagacctcatgttctctaccagcacagggcagctgagctgagttc
cagaacagcagcctctgctccacacccgtaccctggcaatagtacctggtccctccatct

 1.02 Intr +   3223   3617  395  1  2   43   99   650 0.997  56.46
gtgttattgagaggcatcagtaaggcagtgcatgttcccagcaggagccaggagatagaa
gtgttgtagggggtctggctcatgaagcataggctggcgaggcagcagcctggggtaggg
tgtcaggacccctccctcccaaccatggcagacacagcgccctctcttgttcacacacag
TGGCGGCCTGGTCCTCCTGAAGGTGAAGGCAAAGGTGCGACAGTGCCTGCAGGAGCGGCG
GACAGTGCCCATTTTGTTTGCCTCTACCGTTCGGCGCCACCCCGACAAGACGGCCCTGAT
CTTCGAGGGCACAGATACCCACTGGACCTTCCGCCAGCTGGATGAGTACTCAAGCAGTGT
AGCCAACTTCCTGCAGGCCCGGGGCCTGGCCTCGGGCGATGTGGCTGCCATCTTCATGGA
GAACCGCAATGAGTTCGTGGGCCTATGGCTGGGCATGGCCAAGCTCGGTGTGGAGGCAGC
CCTCATCAACACCAACCTGCGGCGGGATGCTCTGCTCCACTGCCTCACCACCTCGCGCGC
ACGGGCCCTTGTCTTTGGCAGCGAAATGGCCTCAG
gtgagccccaagggggcgggggacaagcaggaaccccatgggatcttacacagaccacag
ctcccttccagccctgccaaggctgtgtgggtcagtggttaagggcacagagtggagtca
gacagcttaggcagtgccacgagtaaacgagatcctggggaagggactgatttctctgag

 1.03 Intr +   6613   6771  159  2  0  129   80   107 0.998  14.47
gcccatggctaatagaaccattgccggtgcccctgtcaacactgaaggcccagttgcttc
actgcctctcctcctgcccagccagtatcctcagcaacatggccagccctgctgggagca
gaggtccctgggaacatggggttttctggcctgcctgctgactgccctgtctccccacag
CCATCTGTGAGGTCCATGCCAGCCTGGACCCCTCGCTCAGCCTCTTCTGCTCTGGCTCCT
GGGAGCCCGGTGCGGTGCCTCCAAGCACAGAACACCTGGACCCTCTGCTGAAAGATGCTC
CCAAGCACCTTCCCAGTTGCCCTGACAAGGGCTTCACAG
gtgggctccatcccctccccatagaggggctctcacacaggccctggacagagcactggc
ctcagtgccagaaggaggcttttctggaaacttgccatgtgcctggaacatgtcacgtca
cctccctttttccatctggaaaatggtgacagtaaacctgggccactccagggttactgt

 1.04 Intr +   8380   8449   70  2  1  106  110   138 0.999  16.53
ttgttggaatggatgccggtgttagagctgaatggtatctgaggttatcagaacaggctt
cctagcaagggtgtgatgggaacaggtgttgaagggtgcacacctgcaggtgtccatttg
tgtgaccctttgcccagccctgagctgcccccgacagccactcgcgtctgttttctttag
ATAAACTGTTCTACATCTACACATCCGGCACCACAGGGCTGCCCAAGGCCGCCATCGTGG
TGCACAGCAG
gtaaggggcaggtgcccagggtggggtaggcacaggcagggctggggagcctccttctgc
ctttctagggcccgctcagcccttggccctgtgccttcccaggtattaccgcatggctgc
cctggtgtactatggattccgcatgcggcccaacgacatcgtctatgactgcctccccct

 1.05 Intr +   8552   8643   92  2  2  107   93   275 0.999  30.04
ttctttagataaactgttctacatctacacatccggcaccacagggctgcccaaggccgc
catcgtggtgcacagcaggtaaggggcaggtgcccagggtggggtaggcacaggcagggc
tggggagcctccttctgcctttctagggcccgctcagcccttggccctgtgccttcccag
GTATTACCGCATGGCTGCCCTGGTGTACTATGGATTCCGCATGCGGCCCAACGACATCGT
CTATGACTGCCTCCCCCTCTACCACTCAGCAG
gtaactctagggctgtcacacagcctccagcacctgccaggtctctaggaaccccacccc
catcaggcagtgtgctgcagtagaaacacacagctttgggccaggcgcagtgactcacac
ctgtaatcccagcactttgggaggccaaggtgggcggatcacttgaggccaggagttcga

 1.06 Intr +  10706  10815  110  0  2   83  101   213 0.573  22.60
gagcctggtgatggaagccggggaggcttcttggaggaggtcacccaaggcaggcagatg
tgaggtgcagaagcctgcagggcagcacaagcctgcctggctggatggcagtatcactga
tttggggccggggagggtcttcatctcgctgaccctcaggggccatccctctgcctccag
GAAACATCGTGGGAATCGGCCAGTGCCTGCTGCATGGCATGACGGTGGTGATTCGGAAGA
AGTTCTCAGCCTCCCGGTTCTGGGACGATTGTATCAAGTACAACTGCACG
gtgagcgagagcgggaagggtgagctgtccctttcccctagttaccctcttcccaactac
actccggggcatctgtcttatagctgaggtggccagtcattccaaagggctcatttgtgg
caaagttcccattgttcagatgggaaggctgagacccggagagggaaaggatggcatggc

 1.07 Intr +  11093  11302  210  1  0   10   80   305 0.628  21.53
cattccaaagggctcatttgtggcaaagttcccattgttcagatgggaaggctgagaccc
ggagagggaaaggatggcatggccagcccctggggagagtaggggcttgagggatcagga
gaatcctagtgtagtgagggcagcctctggagcctcgaatcacaccaagttcacccccag
ATTGTGCAGTACATTGGTGAACTGTGCCGCTACCTCCTGAACCAGCCACCGCGGGAGGCA
GAAAACCAGCACCAGGTTCGCATGGCACTAGGCAATGGCCTCCGGCAGTCCATCTGGACC
AACTTTTCCAGCCGCTTCCACATACCCCAGGTGGCTGAGTTCTACGGGGCCACAGAGTGC
AACTGTAGCCTGGGCAACTTCGACAGCCAG
gtgcggccaggttggggatgggcgaggctgctgcagggatggcccacagaaggcactgga
tgcagaggggagggcagagttcgagcgtgagagtgtgggtgctggagtcccacttccccc
tcattgtccagttttgggcccatggtgagagagcccaggcccaagtcttggccttcgcag

 1.08 Intr +  11483  11609  127  1  1   56   46   292 0.913  22.56
gtgcggccaggttggggatgggcgaggctgctgcagggatggcccacagaaggcactgga
tgcagaggggagggcagagttcgagcgtgagagtgtgggtgctggagtcccacttccccc
tcattgtccagttttgggcccatggtgagagagcccaggcccaagtcttggccttcgcag
GTGGGGGCCTGTGGTTTCAATAGCCGCATCCTGTCCTTCGTGTACCCCATCCGGTTGGTA
CGTGTCAACGAGGACACCATGGAGCTGATCCGGGGGCCCGACGGCGTCTGCATTCCCTGC
CAGCCAG
gtctgccacttcggggtcagagagggaggggttggcctgggaaggaaggaggccaggcgc
gtgtggatggggagccttgttctgaccagtggccatcagttatctctgctcttagggtta
caagttactcatttatttgtgtatccatccattcattcattcattcgccattctatctgt

 1.09 Intr +  13121  13258  138  0  0  103   68   333 0.999  33.74
aacccaggaggtagaggttgcagtaagccaagattgcactgctgcactccagcctgggca
acaagagcaaaactccgtctcaaaaaaaaaaaaaaaaaaaaagacgcagggtacacctgg
tgacaggacgggtgggagaggctgcctagggcagatctgaccctgccttccccaccccag
GTGAGCCGGGCCAGCTGGTGGGCCGCATCATCCAGAAAGACCCCCTGCGCCGCTTCGATG
GCTACCTCAACCAGGGCGCCAACAACAAGAAGATTGCCAAGGATGTCTTCAAGAAGGGGG
ACCAGGCCTACCTTACTG
gtgggtccccagcccttcacagccccttcctgagggttgggggaggaggggaccttctcc
cacctccagaggacaccttcccaggactcccccagtcctggcccttgtggtcaaacaaat
ccttgggctccagcaaagcctccctggcttgagccctggtctcagagctggccaggccca

 1.10 Intr +  13466  13630  165  0  0  114   91   374 0.997  40.75
tcctgagggttgggggaggaggggaccttctcccacctccagaggacaccttcccaggac
tcccccagtcctggcccttgtggtcaaacaaatccttgggctccagcaaagcctccctgg
cttgagccctggtctcagagctggccaggcccagccctgcctcatccggcccctccctag
GTGATGTGCTGGTGATGGACGAGCTGGGCTACCTGTACTTCCGAGACCGCACTGGGGACA
CGTTCCGCTGGAAAGGTGAGAACGTGTCCACCACCGAGGTGGAAGGCACACTCAGCCGCC
TGCTGGACATGGCTGACGTGGCCGTGTATGGTGTCGAGGTGCCAG
gtatgtgcaggcaggcgcgaggtgtgggtagggaggcaccacccaggggcaccaccagct
actcagtgtctaccctgccacccccaggaaccgagggccgggccggaatggctgctgtgg
ccagccccactggcaactgtgacctggagcgctttgctcaggtcttggagaaggaactgc

 1.11 Intr +  13718  13864  147  0  0   97   89   171 0.931  18.82
aaggtgagaacgtgtccaccaccgaggtggaaggcacactcagccgcctgctggacatgg
ctgacgtggccgtgtatggtgtcgaggtgccaggtatgtgcaggcaggcgcgaggtgtgg
gtagggaggcaccacccaggggcaccaccagctactcagtgtctaccctgccacccccag
GAACCGAGGGCCGGGCCGGAATGGCTGCTGTGGCCAGCCCCACTGGCAACTGTGACCTGG
AGCGCTTTGCTCAGGTCTTGGAGAAGGAACTGCCCCTGTATGCGCGCCCCATCTTCCTGC
GCCTCCTGCCTGAGCTGCACAAAACAG
gtgtgtccctcccctgctccagctctcggatcccaggtcccttcccgtttccttctggag
agacccggttggctgttacttgacctctgcacacagcctggccgggcagttggtaaagtg
acctgcctgtgtagaggtgagcagacggggctggcagagaagacacacattgttccttag

 1.12 Term +  18402  18559  158  1  2  128   37   335 0.999  30.81
actttgccacagctgctgtatgaccattctttgcaaactgtaaagggctgtgcctcctcc
cccacttccctcccctgtttgtcctccagccctgctccctgccttcctcagtactggtgg
ttgggaagctgggagctcgggcccctgccctgcactgagtcttcttccctgctctcccag
GAACCTACAAGTTCCAGAAGACAGAGCTACGGAAGGAGGGCTTTGACCCGGCTATTGTGA
AAGACCCGCTGTTCTATCTAGATGCCCAGAAGGGCCGCTACGTCCCGCTGGACCAAGAGG
CCTACAGCCGCATCCAGGCAGGCGAGGAGAAGCTGTGA
ttccccccatccctctgagggccggcggatgctggatccggagccccaggttccgcccca
gagcggtcctggacaaggccagaccaaagcaagcagggcctggcacctccatcctgaggt
gctgcccctccatccaaaactgccaagtgactcattgccttcccaacccttccagaggct

Predicted peptide sequence(s):


>SLC27A4_1|GENSCAN_predicted_peptide_1|643_aa
MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL
KVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQA
RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFG
SEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDAPKHLPSCPDKGFTDK
LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG
NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKK
GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE
VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL