GENSCAN 1.0	Date run: 17-Jan-104	Time: 02:10:04

Sequence OR2K2_1 : 4773 bp : 36.98% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1217   17  0  2   68  115    15 0.583   1.99
ttctttgaagtaatgttttataataatctaataaattttttattattagagaaatctatt
aaatataaaatttggcagagaaattcataagatgaaagcaatttttaagaacatgtatat
atgaaaataggaaagactcagtggagaaagaaaacggttgaaggtttattaaaaggcaat
ATGAGTGCAGAAGCAAG
gtaagttttttgtaataattttttgttaataatgtgaaatgtaaggaaaaaatatacaac
tttaagtttctgactgtcctgctagaaactagttttgccctgcagcgacccctctgtggg
aatctcattgatcacaagtgaaattctggaagtgctaaagttagtttgctcaagttcact

 1.02 Term +   2575   3574 1000  1  1   96   38   361 0.809  22.46
taaattttgttgtggaagaatcaacttatgtacatcaacctgctcccccccttacatcaa
taaacacactatcctgtgatttcttgtagtaaaattgcatttataatagtgaaaataagt
ttgagagtattttcctaactaaatgaatatcacactttattcatttctttatgtcctcag
ATTAAATGAAGGGAATAGTACTGGAAGAAATATAGATGAAAGAAAGAAAATGCAAGGAGA
AAACTTCACCATTTGGAGCATTTTTTTCTTGGAGGGATTTTCCCAGTACCCAGGGTTAGA
AGTGGTTCTCTTCGTCTTCAGCCTTGTAATGTATCTGACAACGCTCTTGGGCAACAGCAC
TCTTATTTTGATCACTATCCTAGATTCACGCCTTAAAACCCCCATGTACTTATTCCTTGG
AAATCTCTCTTTCATGGATATTTGTTACACATCTGCCTCTGTTCCTACTTTGCTGGTGAA
CTTGCTGTCATCCCAGAAAACCATTATCTTTTCTGGGTGTGCTGTACAGATGTATCTGTC
CCTTGCCATGGGCTCCACAGAGTGTGTGCTCCTGGCCGTGATGGCATATGACCGTTATGT
GGCCATTTGTAACCCGCTGAGATACTCCATCATCATGAACAGGTGCGTCTGTGCACGGAT
GGCTACGGTCTCCTGGGTGACGGGTTGCCTGACCGCTCTGCTGGAAACCAGTTTTGCCCT
GCAGATACCCCTCTGTGGGAATCTCATCGATCACTTCACGTGTGAAATTCTGGCGGTGCT
AAAGTTAGCTTGCACAAGTTCACTGCTCATGAACACCATCATGCTGGTGGTCAGCATTCT
CCTCTTGCCAATTCCAATGCTCTTAGTTTGCATCTCTTACATCTTCATCCTTTCCACTAT
TCTGAGAATCACCTCAGCAGAGGGAAGAAACAAGGCTTTTTCTACCTGTGGTGCCCATTT
GACTGTGGTGATTTTGTATTATGGGGCTGCCCTCTCTATGTACCTAAAGCCTTCTTCATC
AAATGCACAAAAAATAGACAAAATCATCTCGTTGCTTTACGGAGTGCTTACCCCTATGTT
GAACCCCATAATTTACAGTTTAAGAAACAAGGAAGTCAAAGATGCTATGAAGAAATTGCT
GGGCAAAATAACATTGCATCAAACACACGAACATCTCTGA
ttgggtccctatggttttaccagagatgtgcccctggcagagctcatcagagaaattcga
gacaacatacaacctcttagaactctgatcggatcttatctctatataatttcacagtta
tgagctgcatacacagagtgattgcctattaataatagtaggtttcaatttgcatttgtt

Predicted peptide sequence(s):


>OR2K2_1|GENSCAN_predicted_peptide_1|338_aa
MSAEARLNEGNSTGRNIDERKKMQGENFTIWSIFFLEGFSQYPGLEVVLFVFSLVMYLTT
LLGNSTLILITILDSRLKTPMYLFLGNLSFMDICYTSASVPTLLVNLLSSQKTIIFSGCA
VQMYLSLAMGSTECVLLAVMAYDRYVAICNPLRYSIIMNRCVCARMATVSWVTGCLTALL
ETSFALQIPLCGNLIDHFTCEILAVLKLACTSSLLMNTIMLVVSILLLPIPMLLVCISYI
FILSTILRITSAEGRNKAFSTCGAHLTVVILYYGAALSMYLKPSSSNAQKIDKIISLLYG
VLTPMLNPIIYSLRNKEVKDAMKKLLGKITLHQTHEHL