GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:37:41

Sequence NOXA1_1 : 13390 bp : 63.18% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1316   1492  177  1  0  122   88   241 0.989  24.91
ccggggaggggcgggcgcctgccgccagggggcgccgcggggcagcggggttgcacctgg
cgcttggcgcccgcacctctgcccgcctcggagaccccgcagccccgcgccgccgcctgg
ccccggccccggcccctccgcgggatcctggcccctcctcgagcgccgccaccggccgcc
ATGGCCTCTCTGGGGGACCTGGTGCGCGCCTGGCACCTGGGCGCGCAGGCTGTGGATCGT
GGGGACTGGGCCCGCGCCTTGCACCTCTTCTCGGGCGTCCCGGCGCCGCCCGCCAGGCTG
TGCTTCAACGCGGGCTGCGTGCACCTGCTGGCCGGGGACCCCGAGGCCGCGCTGCGG
gtgagcggggcgtggggaggccggtgcgggcgacgcctccgcctcgagcccctggggagg
gcccagcgcccctccccgaccgtcacggggtcgccctgccgcccccgacccagcgaacgc
cccggcaggtgggagccgagcaggggggccgcacctgagctaagcgaggccgcgctgggg

 1.02 Intr +   4034   4116   83  1  2   78  113   141 0.946  15.19
agtggcgacagccctgcccaggcaggggctccgaaggttcctggacaggagcaggagggg
ctgtggggggtccccaggggctgacggaattccgtggccctgtcacccatcacgctgtat
ctgtgatgctgcgtgaccaggttacagaccttggcatcccgtgggcatttttgtccccag
GCATTTGACCAAGCCGTGACCAAGGACACCTGCATGGCGGTTGGCTTCTTCCAGCGAGGA
GTGGCCAACTTCCAGCTGGCAAG
gtgagtacaggggtgccttgttccttctctgacggccctttgtctccctgcagagtccac
tcctgcacctcctcctcctccctctccatccactccctcctcttgcccaccccctcctcc
atggttcctggctccagggaaacctgagactgtggccctcgcctctgctgagcgccaccc

 1.03 Intr +   5819   5927  109  2  1   77   78   189 0.957  18.25
atgtgcatggacccctggcccaccagacctgagtgtgcagacctaggcaccgcactgccc
tccctcaggtctccttggaaccaggtgttgggggcggctcgagcggggctggtgtgaaag
ctgcctaaccacagccccatctccgccctgtgctgctgaggggaccccggctgcccacag
GTTCCAGGAGGCTCTGTCTGACTTCTGGCTGGCCCTGGAGCAGCTGAGGGGCCACGCTGC
CATCGACTACACGCAGCTGGGCCTGCGGTTCAAGCTGCAAGCCTGGGAG
gtgaggccgggcagggctcactgtgctgctggctgtggggtgtccacgggcggtggcact
gtcacaggagggccctgtggactggggagcgcctctggccgaagctcttggtgccatgga
ataccctggccactccttgacccgcaggaggttctggtggcagtggaggtggagggacca

 1.04 Intr +   6668   6802  135  1  0   89   94   113 0.997  13.95
ggggagaagccaggtggggggactgggggagaggctgggtggggggatgggggaggggcc
aggtggggggactgggggaggggctgggtgggcagaccgagggaggagctgggtggggga
accgggagagggcctgggtggggcatcaggcccctgccatcaccttggccccactcccag
GTGCTACACAATGTGGCGTCGGCACAGTGCCAGCTGGGGCTCTGGACAGAGGCGGCCAGC
AGCCTAAGGGAGGCCATGTCCAAGTGGCCGGAGGGGTCCCTGAATGGCCTGGACTCAGCC
CTGGACCAAGTGCAG
gtgaggagtgccagcccggtcatggttttgggctggtgcctaccaaagctcctcaagacc
aatttcatgagatgaagaagcttccggagggagatggccctagtgcccagtttcgggtgc
caggcgggggcttcctgtgacctgcgggaagggggtggggggcccaagcggccccttctg

 1.05 Intr +   7089   7169   81  2  0   45   98    97 0.406   7.39
ccagtttcgggtgccaggcgggggcttcctgtgacctgcgggaagggggtggggggccca
agcggccccttctgctccaaggcacaggggctctgcggctgcaggcctggttggtcaccc
cgtctgcatctgctggatacccaccccctccagagacggggctcactgccgccacggcag
GTCCCCAGGGGCGAGGTCTTCCGGCCCCACCGGTGGCACCTGAAGCACTTGGAGCCCGTG
GATTTCCTGGGCAAGGCCAAG
gtaaaggtggggacggcgtcctggggcatggcggctggtgctgagccctcgaactgtgtt
cccagggatggggggaggtgcagtccaggccaccgtaagggccaggagggtagagagtgg
gcccacagccatcctcaaactggcgcccacggtaggggggcggtgccccaaatggggctg

 1.06 Intr +   8570   8629   60  1  0  106   94    66 0.980   9.07
gatgtttttctccatcagacatttccctccatggtggtctggcagacgtgggccgggcat
gggcagctgtcacccagcccccggggacttagagctgcggggcacggtggggcgggctgc
agggagcagaccctgctgggccgctgatccctgacccagcgtccccactgtccccgccag
GTGGTGGCCTCTGCCATCCCCGACGACCAGGGCTGGGGCGTCCGCCCTCAGCAGCCACAG

gtgggtttgcggcccctcagacccctgcctggcctcacccagctttctgggaaagaaaat
gctgcacaagctctgagccctcctggggctgcgaagttcctctgatgggaggtgtggggt
ggccatcccatccctgtgtaagacctggggaaaccactcttcaaggttcaggaggaggga

 1.07 Intr +   8861   8886   26  1  2   74   91     1 0.961  -3.05
aaagaaaatgctgcacaagctctgagccctcctggggctgcgaagttcctctgatgggag
gtgtggggtggccatcccatccctgtgtaagacctggggaaaccactcttcaaggttcag
gaggagggagggcggcccccgacccttaaccagagcgaggttgttgctttgtgtccacag
GGACCAGGAGCGAACCATGATGCCAG
gtaggaggggctgactgggccctgcgagcgcgtgcctttcctgctgggcagaggccctcc
acatggggccacgcgggccgggcacaggagggcagtcagatgggcagggcctgagagcct
ccctcctctccctaggtccctaatcatggactccccaagagctggcacccaccagggccc

 1.08 Intr +   9022   9127  106  1  1  116   96    85 0.994  13.48
tgttgctttgtgtccacagggaccaggagcgaaccatgatgccaggtaggaggggctgac
tgggccctgcgagcgcgtgcctttcctgctgggcagaggccctccacatggggccacgcg
ggccgggcacaggagggcagtcagatgggcagggcctgagagcctccctcctctccctag
GTCCCTAATCATGGACTCCCCAAGAGCTGGCACCCACCAGGGCCCCCTCGATGCAGAGAC
AGAGGTCGGTGCTGACCGCTGCACGTCGACTGCCTACCAGGAGCAG
gtgcgtgggcctgggcctcttcccctgctgggggtcggtgcttctgctgcctccgcagac
tggggaccacaatgggaccaacatgagggtggagggagcagctcgctggggggtagacgg
ggccgggctcacccgtggtcctggcccagcccagccagatgggaggatgcctggctgtgc

 1.09 Intr +   9186   9239   54  2  0   99   26    56 0.441   0.82
tccctcctctccctaggtccctaatcatggactccccaagagctggcacccaccagggcc
ccctcgatgcagagacagaggtcggtgctgaccgctgcacgtcgactgcctaccaggagc
aggtgcgtgggcctgggcctcttcccctgctgggggtcggtgcttctgctgcctccgcag
ACTGGGGACCACAATGGGACCAACATGAGGGTGGAGGGAGCAGCTCGCTGGGGG
gtagacggggccgggctcacccgtggtcctggcccagcccagccagatgggaggatgcct
ggctgtgcccgaggcgagtgggcattggccatcaggacaggagagaggtggtgtccagtg
gagacatccacgtagccctgcaggccctcagcccccaggaccacctcagtttggccattg

 1.10 Intr +  10815  10860   46  2  1   95   80    23 0.439   1.32
acccagccccatcctaaggcagccgacttgtggccagtgccctgaattcaacacccacag
accacctgctgggtgctggccgggcacacaggccacacccttggtgtgggctctgcgagg
acagtaccggcctccagcacctgaccgccccagcccacccagcctgtgcttctcttgcag
AGGCCCCAGGTGGAGCAAGTTGGCAAACAGGCTCCTCTCTCCCCAG
gtatgggcgtcctcagcggcggggtccccgggtgaaggaggaagctgctggtgcatgggt
gccggctgccctccacccacagggcccactttggtggtagtggctgtgtcagtcttgctc
tgtcctacagggctgccggcaatgggggggcctggccccggcccctgtgaggaccccgcg

 1.11 Intr +  10991  11049   59  0  2   88   78    22 0.319   0.94
gcagaggccccaggtggagcaagttggcaaacaggctcctctctccccaggtatgggcgt
cctcagcggcggggtccccgggtgaaggaggaagctgctggtgcatgggtgccggctgcc
ctccacccacagggcccactttggtggtagtggctgtgtcagtcttgctctgtcctacag
GGCTGCCGGCAATGGGGGGGCCTGGCCCCGGCCCCTGTGAGGACCCCGCGGGTGCTGGG
gtaagaggctctagacccttcacctgtcagtcacctgagggaggctgaggccaagcccca
tccctcagaatcaaggcttgcaagcccccctcacctgcccagtctctgtccacacccctc
gggctgaagacggccctgaccaggccctgggcctcagcgaccacccctccccctcctgcc

 1.12 Intr +  11239  11393  155  0  2   82   80   136 0.992  12.26
tctagacccttcacctgtcagtcacctgagggaggctgaggccaagccccatccctcaga
atcaaggcttgcaagcccccctcacctgcccagtctctgtccacacccctcgggctgaag
acggccctgaccaggccctgggcctcagcgaccacccctccccctcctgcctggacccag
GGAGCAGGTGCAGGGGGCTCCGAGCCCCTGGTGACTGTCACCGTGCAGTGCGCCTTCACA
GTGGCCCTGAGGGCACGAAGAGGAGCCGACCTGTCCAGCCTGCGGGCACTGCTGGGCCAA
GCCCTCCCTCACCAGGCCCAGCTTGGGCAACTCAG
gtgggccagaaagcccccggtggctgcggtggagctgggcaccgccccgactgaggcagc
tgctggaagagggggtggcagaggtcactgccctccctgcaggccccacccaggaggccc
cctctgaggaatctctttgcagttacctagccccaggtgaggacgggcactgggtcccca

 1.13 Intr +  11536  11650  115  1  1   50   84   100 0.993   7.42
caagccctccctcaccaggcccagcttgggcaactcaggtgggccagaaagcccccggtg
gctgcggtggagctgggcaccgccccgactgaggcagctgctggaagagggggtggcaga
ggtcactgccctccctgcaggccccacccaggaggccccctctgaggaatctctttgcag
TTACCTAGCCCCAGGTGAGGACGGGCACTGGGTCCCCATCCCCGAGGAGGAGTCGCTGCA
GAGGGCCTGGCAGGACGCAGCTGCCTGCCCCAGGGGGCTGCAGCTGCAGTGCAGG
gtgagccaagggcgaggcaggggcaggggcaccctgaggggcggtggaggcccctcctcc
cagtgcccggcccgacctgcagcccactctcctgcctcagggagccgggggtcggccggt
cctctaccaggtggtggcccagcacagctactccgcccaggggccagaggacctgggctt

 1.14 Intr +  11751  11865  115  2  1   91   97   104 0.955  12.79
ccatccccgaggaggagtcgctgcagagggcctggcaggacgcagctgcctgccccaggg
ggctgcagctgcagtgcagggtgagccaagggcgaggcaggggcaggggcaccctgaggg
gcggtggaggcccctcctcccagtgcccggcccgacctgcagcccactctcctgcctcag
GGAGCCGGGGGTCGGCCGGTCCTCTACCAGGTGGTGGCCCAGCACAGCTACTCCGCCCAG
GGGCCAGAGGACCTGGGCTTCCGACAGGGGGACACGGTGGACGTCCTGTGTGAAG
gtagggtgggcatggcccttcccaggcagcaccgtggtgcccggggtgtggggggcttag
agctcggcctgtgctgtgagcagacgtggcacccagaggccacgcctgggtaacgccctg
cagagcccgatgtcccccttgcagtggaccaggcatggctggagggccactgtgacggcc

 1.15 Term +  11989  12146  158  2  2   30   39   191 0.669   7.45
aggggccagaggacctgggcttccgacagggggacacggtggacgtcctgtgtgaaggta
gggtgggcatggcccttcccaggcagcaccgtggtgcccggggtgtggggggcttagagc
tcggcctgtgctgtgagcagacgtggcacccagaggccacgcctgggtaacgccctgcag
AGCCCGATGTCCCCCTTGCAGTGGACCAGGCATGGCTGGAGGGCCACTGTGACGGCCGCA
TCGGCATCTTCCCCAAGTGCTTCGTGGTCCCCGCCGGCCCTCGGATGTCAGGAGCCCCCG
GCCGCCTGCCCCGATCCCAGCAGGGAGATCAGCCCTAA
tgatgctgtgtccatgatgcttttaataaaaacaacccccactgcagtctcaccctccaa
gtgggtgtgggaggccgggctggcccagcagaagcccccaggcctggactccatccatct
gctcagacaacagcagggagagcgggggtccaggtggggcagctccctcccttccacccc

 2.03 PlyA -  12392  12387    6                              -9.40
 2.02 Term -  12891  12700  192  0  0   98   40   240 0.981  18.59
 2.01 Intr -  13124  12990  135  2  0  102   62   229 0.996  23.65

Predicted peptide sequence(s):


>NOXA1_1|GENSCAN_predicted_peptide_1|492_aa
MASLGDLVRAWHLGAQAVDRGDWARALHLFSGVPAPPARLCFNAGCVHLLAGDPEAALRA
FDQAVTKDTCMAVGFFQRGVANFQLARFQEALSDFWLALEQLRGHAAIDYTQLGLRFKLQ
AWEVLHNVASAQCQLGLWTEAASSLREAMSKWPEGSLNGLDSALDQVQVPRGEVFRPHRW
HLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPL
DAETEVGADRCTSTAYQEQTGDHNGTNMRVEGAARWGRPQVEQVGKQAPLSPGLPAMGGP
GPGPCEDPAGAGGAGAGGSEPLVTVTVQCAFTVALRARRGADLSSLRALLGQALPHQAQL
GQLSYLAPGEDGHWVPIPEEESLQRAWQDAAACPRGLQLQCRGAGGRPVLYQVVAQHSYS
AQGPEDLGFRQGDTVDVLCEEPDVPLAVDQAWLEGHCDGRIGIFPKCFVVPAGPRMSGAP
GRLPRSQQGDQP

>NOXA1_1|GENSCAN_predicted_peptide_2|108_aa
VEASYPGQDRWLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLN
LTGMIPADAPAQWRAESYGVWVAKVVFMVLALVAVVGAALVQLFWLQD