GENSCAN 1.0	Date run: 17-Jan-104	Time: 01:21:36

Sequence KIAA2026_1 : 90476 bp : 36.15% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1766  566  0  2   97  111   817 0.821  79.46
cgcaccgagccgagccggcggctgaggagagccaggcccgatgtggcgggggctacgcgc
cgcggccgagccgtgaggaagcggctcgcgctcacgcgtcccccagcacctcgagcggct
gttccacaccgcccagcctaggcctgccggggcatgagtgtgcccgggacgccgggagcg
ATGGAGCCGGCTGGGGAGGAAGAGCGGCCGCCACCGGCGGCCGAAGGAGAGGACGACGAG
GAGGAGGTGGCAGCGGCGGCCCAGACCTCAGGGCCGGCCCACGGAAGGAGTGCCTCCTCG
CTGGAGGACGCGGACGATCAGGAGGAAGAGATGGAGGCGATGGTGATCGGAGGCGGTTGC
TGCAAGGAGCAGGAGCTGACCTACGAGCTACAGCAGGGCTACCGCATCCTGGGCGAGTTC
CTGCAGGAGAAGCACCGGGGCCTCACCGCCCCCTTTCTGCAGCCCTTGGGGGGCGTTGCC
ACCGCGGAGGAGGAGGTGGCGGAAGGGCCGCGCAGCGGGGGCCGGGGCGGTCGCGCCTTC
CCGCAGCAGCCCGGACAGGGCATGTGTCTGCTGCAGATGGAAGAGAAGTTCGCCAGCGGC
CAGTACGGGGGCATCACCGAGTTCGTGGCGGACTTCAGGTTGATGCTGGAGACGTGCTAC
CGCCTGCACGGAGTGGACCACTGGATCTCCAAACAGGGCCAGAAGCTGGAGATGATGCTG
GAGCAGAAGTTAGCGCTTCTCTCTCG
gtaagcgagcccggtccccggtgggactgacagactgacacaaacacacactcacacgtg
cccgaggatgggctgggccaggggcctgggggcggcgctgataggtgctgagtcggtgct
ggagaagcccgggaggaggagcggcgctgggcggggaccggaggggtgtggtgggtgtgg

 1.02 Intr +  20416  20616  201  1  0   60   94   196 0.989  14.88
ttatgacataaggagtatgagaaattgtgtagggaggataaaaagttagaacaaagctaa
gtaagtaaggtttaaatacttttatgtatttagcaaaagggattcttaagttgctggcta
agggggtttattgcttatccagaagatttgaccttgtgaattgacttattcttctccaag
GCACTTGAGAGAAAAGACAACGATAGCAGTTACATCTAGAGGCTATTATGGATTGGAGGA
TGAGAAGGGAACTGCATGTACCTCAACAAGGCGTCGGTCAACACCGCGAAGTTTGGCAGG
CTTGACAAGTGGAGTTTTTGAATCTATAATGGTTCAAGTTTTGAGACAGGAAGAACAGCT
GAGAGCAAAAGAAGAAAAAAG
gtaaatgttaagaaaaaaattcataatttcagctgcataatttttatgtgcccatatcag
atttctgggcccattttagtagtgttctaaaatgcattgttacaaaagtatgaattcata
atgaaatatcgcaataaaatttgtttaaaatgtaattttaaaatttaaaaccacttatct

 1.03 Intr +  21462  21511   50  0  2   92   55    31 0.139  -2.39
tgttaatgctggtcagaggcaatttataatattttgttgctcttcttgtaataataaatg
taacttgctttgaaatttgtaggattgaaactcagccttgagactttctaccatcatact
ttttccagcagtaattaatttggaaacctgctgtaaagtattttttttttccttgtgcag
AGCTTCACAGAACTACTCCTACTATAGGAAAGGAGGGCTTATGGAAAGGG
gtaaagattaacttgacagtagcgtacagtagattggaatggggagaattgaagaaaagg
aaggcttgtacgaagaaggctgtagtagtctacatctccactactggtcaccacctccaa
tactggtcaccagaaattggaagaaatcagattgtcctgagaacaattaatagaacttag

 1.04 Intr +  31799  31925  127  0  1  116   99    35 0.929   6.22
ccttcctcacatctctttagtattcatagtctgaggctagattccataatcctcccctga
aaggtacagtgtatgaggaacagcagcagtgtgagtagcagcccttgattagcttcagat
agtgcacacagatggcattatcacacttcaactgtgtcatgaattttcttcctcttctag
GAGCAAGTCAGTTGGTGCTAACTTTGGCCTACCAGGCAAACTGTGTTTCTGTCTCTTATA
CTGACCTGCTAGGAAAACCTGGGGGAAGTTATTTCACCTTTCTGTATGTCCTTAATATTC
GCAGCAG
gtaaataatttgtgaaattaccttatcaccaatctttatattggccaaaagttgcttttc
actgctttaggcaaagcaagtccataaaagttttttcatctactccaactttccctttca
ttttcttccccaagcactagctgtcactctttcacttctgcagaacatgtaacactcttc

 1.05 Term +  39525  40977 1453  0  1   67   42   821 0.562  64.60
agctgagattgcatcactgcactacagcctgggggacagagcgagactctgtctcaaata
aataaataaataaaactaggacagttgattgcctttttggctaaagataaatatacttaa
aatttatcattttatggtaccctctgaataataatagtataatttgttaaatttctttag
GCTTCGGGAGCAGGAAAGAAAAGAAGCAGAAGAAGCTAGTCAAAAGGAAATAGAAGAATG
GGAAAGAAAACTTCTAGCTCAAGCAGCTCCAACTTGTATGGAGACCATGTGGGAAATTCC
AGCTATTGGGCATTTCCTTTGTTTAGCTCAGCAAATTCTAAATTTGCCAGAAATAGTCTT
TTACGAATTGGAACGTTGTCTTCTGATGCCTCAGTGTAATGCTTTTCTATCGAAAATAAT
GACTTCTCTATTAAGTCCTCCCCATCGCAGACCTACCTTACATCGAAGACCTACTTTGCC
TTATAGGACCTGGGAAGCAGCGCTGAGGCAGAAAGTACAACAGTGGTACACTGCTGTAGG
GCAAACTGAAAATCCTGATAACTGTGCTGAAAAACTGGGGTTGTGTCCTCAGTTTTTTAA
AGTTCTTGGAGAAGTTAATCCATTGGAAGAAAAACCTTTTCACGAACTACCTTTTTACCA
AAAAGTGTGGCTACTTAAGGGTCTTTGTGACTTTGTGTATGAAACACAAAAGGAAGTTCA
AGATGCTGTACTTGGACAGCCTATCCATGAATGCAGGGAAGTTATTCTTGGTTATGATTA
TTTGGAGAATGCTTATGTACATTTTCCACAGTTCTGTGGTGCAGATGTACGGATTTATAA
ACAGAGACCCTTTCAGGCCCCAGAATTTCCAATTCCACCCATTAAAATACAAAGAGTACC
TCGGATTAAATTGGAGAAATTGAAGTGTGACTATGTTAGTACAAGTAATGGAGAACATAG
ATGTAGCAGAGATAGCCTGCCCTCTTCCTTCAAGAAAGAGCAGGAAAATAATTTTGATCC
AGCTTGCTGTCCTGCTAAAATGATCTTGGATAATCATGACATCTCTGTTGAAATGGGAGT
AAAATCCAACTATGAAATTAGAATTCGCAGGCCTTGTGAAATTAAAAAAACTGATTGTTG
TAAAGAAAATTTAGAGAAACCAAGGAGTCCAGGGGAAGTTACTGGCTTTGGAGAGCCTCT
TAGTCCAGGTGAAATAAGGTTTATAGAAAATCAGGAAAAATACGGTGAAGCTTCCAGAAT
AAAGATTGAACCCAGTCCATTAAAAGAAAATACTCTAAAATCTTGCCAAATACATGTAAA
TGGAAGTCACAGTGATCATCCAGAAATTAACTGCCACAAAGTTGTAAGGGATATTCTATT
AGAGCAGTCACTACAGAGCCACAAGAAACTCAAACTAACTAAAATGAGGGCAAAAAAGAA
GAAAAAGAAAAAAAAGAAATTGAAAGATGTTTTGAATGAAAACTTACAGAGAAAGCGTGA
AGGTCTTCATTCTCTTGCATTCAAGTCTTACAAACCTGAGATCCAGAATAAGTTATTGAT
CATCAAAAAAAAAGCAAAACACAAGAAGCACAAATCTGGTAAGCTAACACAAATGGATGG
GAGTTATATTTAA
gtataattcaaattgttttttccattatgcatcatggatgctttgattgagagagtaaaa
tgcacatgtatgcatgcgtgtatatttgagggtcaaattttattttatattcaatgtgtt
aaaaagccagagcagatgacattttatatacttacaacaaaaaaagtactgatgcagtat

 2.03 PlyA -  42860  42855    6                               1.05
 2.02 Term -  46808  45674 1135  1  1   50   48   473 0.572  29.95
 2.01 Init -  56292  56180  113  0  2   67   64    47 0.187  -0.07
 2.00 Prom -  63812  63773   40                              -2.05

 3.01 Init +  80396  80466   71  1  2   61   94    61 0.807   4.57
gggcagggtgaaggttactctttgatcaggtgtcagggaaagcttccctgatgagttggt
gtttgaacagagaccttaaagaaatgaggaagggagctctgtggatttctgaggggaaag
cagagggaatagaaggtactaaagccctagagttgatagcatgtttggcgtttagtggag
ATGCAAAGAGGCAAGTGTAACCAGAGCAGAGCGAGTGAAGAGAAATGTGGTAACAGGCAA
GAGTCAGAGAG
gtaaggaggaaggaagccagatcatgtagatctttaagaattggagtttttacactgagt
taggtgagaagccattgaagggttttaagcagggaagggacatgatttgatttatgtttt
aaagcaatcactctgttgggtggagataaatgtaataggacaaagatgaaagcagggaaa

 3.02 Intr +  84116  84303  188  2  2   46  115   220 0.982  18.91
tctgtcttcctgagcattggcaagactgaactaagcatcttagacacacttaagattaaa
gcatttctagtgacttaataaaaaatatttccatatgtagtttaaaatgttaaaagttag
tttagattccaagaatttaaatcatatgtattatttattatgttgggcattttatttcag
GAGCCGCCTGAAGAAAGACTATGATGATTTCAGAAGACAACCTGATCATGATACATTTAA
TAGAGAACTATGGACCACTGATGAAGGTGAAGGAGATCTTGGAAAAGACTCTCCTAAGGG
AGAAATCAGTAAGTCTATAGACTCAACAGAACCTCTGGATATCCTGGAGAAAGATCACTT
TGATTCAG
gtaagcattaaactttttttttaagtcaacactgaaggcacaaagagaagtttttgtttg
ctgtgaaggcaaaagataatatggtcaatgaaatatattgattagggaaatctgttatgt
tttgaagaagtagtgtccacatccttataagaagtttctactagcctaggcaacatagcg

 3.03 Term +  85652  89277 3626  0  2   82   38  1598 0.974 138.57
tcatgtcaaagatgaccttacctttgtcttcatcagtggtgctaaggcttttgaatcacc
ctgcagtagatttcttaatacactgccagctcaaagattgactttcttttttacagttga
tgttattactatttagttgctgttttatataaacaaaatgcccgtttttataattttcag
ATGATATGAAGTTGTCAGAAATAGATTTTCCTATGGCTAGAAGCAAGCTGTTGAAAAAGG
AATTGCCTTCAAAAGACTTACCGAAGACACTGCTTAAAACACTTAAACGACAGTCCAAAC
AAACTGATTATGTGGATGACAGCACAAAAGAGCTTTCTCCAAGGAAGAAGGCAAAGTTAA
GCACAAATGAGACAACAGTTGAGAATCTAGAAAGTGATGTGCAGATTGACTGTTTCAGTG
AATCAAAGCATACAGAGCCATCATTTCCAGAGTCATTTGCCTCATTGGATTCAGTACCAG
TGTCTACTCTCCAGAAAGGGACCAAACCCATTCAGGCTTTGCTTGCAAAGAATATTGGGA
ATAAAGTGACCTTAACAAATCAACTGCCTCCTTCCACAGGTAGAAATGCTCTTGCTGTGG
AAAAACCAGTTTTATCTCCTCCGGAAGCAAGCCCGATAAAGCCAGCATTGACCTGCCACA
CCAATACAAAAGGTCCTTTACAAATGGTATACAAAATGCCCTGTGGCCAGTGGTTGCCAA
TAGATCTTCAAAATAGCTCTGTAAAGATTCAGGTGCAGCCTATGGTGGATCCTAAAACAG
GAGAAAAAATCATGCAGCAAGTTCTTATTCTGCCTAAGAATTTTGTGATTCAGCATAAAG
AAGGAAAAGCAGTTGCAAAAGAAGTGCCACCACTTCAACAGAAAGGTACAGAACAACATT
GTTCATCTTTCCCACAGACAACAAATATAAATTCTTCTTTAGCATCAGTTTTTGTCAACT
CACCAGGAACTGTTTCTACCCAACTACCAAATACAGCTTTCAACAAAACAATTACACCTT
TATCAAATATAAGTAGTGCTAGACCACAGCCTTTGTCGCCTGTAACCTCTGTAAGTAACT
TATTAACACCATCAGTTAAGACTAGCCAGAGTGAGGCAGGAAAAGCCAAGAATGCAGTTT
CAGCAGCCACATTCTCCTTGCCCAGTGCTTCACCGACCATTTCCTCCACAGGTCAGCCTC
TGTCATCAACAACAACACTAAATGGGTCTACAAATCCTGGTAGTTCCTTCAACTGTTTTG
CACAACAGACTGCTGATTCTTCTGAAGCAAAGCAAGAGCTGAAAACTGTGTGCATAAGAG
ATTCACAGTCAATTCTTGTTAGGACACGAGGTGGGAACACTGGAGTTGTAAAAGTACAGA
CCAACCCAGATCAAAATTCACCCAATACTGTATCTTCAAGTTCAGTTTTCACTTTTGCTC
CTCAGCTGCAGGCATTTCTGGTGCCAAAATCAACAACTTCTTCCTCTGCTTTTTCACCTG
TAGCTGGAACAACTACTACATCTAGTCTTTCACCTTTTAGCCAAACACCAACTTCTGTTT
CCATTCCAGCTAGCTTTGCCCCATCCATGGGGAAAAATCTCAAACTTACATTAGGCCACA
CCACTGGCAGTGGTGATTTGGGCCACGTGATAGATAAAACTTCACACATGCCCTCTTCTC
CCTTGAAGTCCTCTATTTGTTCTAGTACTCTACTACCATCAACAACAAGTAGTTCGGTAA
GTGTAATTAGCATATCAGCAGCAAATTTTGGACAAAACAATGCAAATATTATTCATACTC
CAACTAAACAGCAACAAGTAGATTATATCACAAAAAGTTACCCTGTTACAAGGTCAGAAG
CAACAGCAGCAACAAATGGAGATGTAATCAGTGGGACTCCAGTTCAGAAACTTATGCTGG
TATCAGCTCCATCTATTCTTTCTTCTGGCAATGGAACTGCAATTAATATGACACCTGCGC
TGACATCTACAGGTGTTTCTGCCCAGAAATTAGTTTTTATTAATGCCCCAGTTCCTAGTG
GTACATCAACCCCAACTCTTGTTGCAGAATCATTAAAACAAACTCTTCCTCCTCCATTGC
ATAAAGCATATGTTAAGACTCCAGAGCAACCCCAAATAGTACTGATTCCGTCTACAGTGG
GCACACCAATAAAAATAAATTCATCACCAGCTGTGTCTCAGATAAAGGATGTGAAAATTG
GACTAAACATAGGTCAAGCAATTGTAAATACTTCAGGCACTGTGCCAGCTATACCATCAA
TTAACATATTACAAAATGTAACCCCAAAAGGAGAAGACAAAAGTAGCAAGGGCTATATTT
TGCCATTGTCAACAAGTGGTAATTCAGTTCCAGTAAGCTCAAATTTTGTGAGTCAGAATA
TTACCCCTGTTAATGAATCAGTGGTTTCTTCAGCAAGAGCAGTAAATGTGCTTTCAGTTA
CCGGAGCAAATTTATCTTTGGGTTCCTTTCCAGTGACCTCAGCCTCTGCTTCAGCTGGGG
CACAACCTCCTGTTTTAGTCAGTGGAAATGATACCTCTTCAAGAATTATGCCTATTTTGT
CAAATAGACTTTGCTCATCAAGTCTCGGAAACACTGTGGCTATATCAACTGTGAAAACAG
GACACCTTGCATCATCTGTTCTGATTTCAACTACACAACCAGTAGTGTCTCCTAAATGTT
TAACATCAGCTTTGCAAATTCCTGTTACGGTTGCCTTACCTACACCTGCGACTACATCCC
CTAAAATAATAAACACAGTTCCACATTCGGCAGCAGTACCAGGAGCCACACGTTCTGTAT
CTATTTCTAAAAGACAATCTCGGACTTCACTCCAGTTCCATTCACCAGGGATTTCAACTA
CAGTGCCAACAAATGTAAACACAAATAAACCTCAAACTGAATTGTCGTCCCTTTCAACAA
GTCCAGGTAAAATAACTAATACGTCCAATTTTGCTTCTCTGCCAAATCAGCAAGCTTTAG
TAAAAACCCCCAGTTACAGTTCTGCTCCAGGTGGCACTACCATTCACACGGCTTCGGCAC
CATCCAATGTAACTAGTCTAGTCGGGAGTCAGTTCAGTGAACCTTGTATTCAGCAAAAAA
TAGTCATCAATACCAGTACACCTTTGGCACCTGGTACTCAGATTATGATTAACGGAACCC
GGTTTATTGTTCCACCACAAGGTCTTGGAGCTGGCAGCCATGTTCTCCTTATATCTACTA
ATCCAAAATATGGAGCCCCCTTAGTTCTTAACAGTGGCCAAGGCATTCAATCTACACCAA
TAGATAACTCTGCCCAGAAGATCACACTAGCATCAAATAATTCCTTAAGTGGCCAACCTC
TACAACATCCTCTAAGAAGCCCTACAAAATTTATAAACTCTTTTGGGAATGCAAGTTCTA
TACCCACAGTACATACATCACCACAACTCATAAACACAACTGCTAAGGTTCCTGTTCCAC
CTCCTGTACCAACAGTATCACTGACTTCAGTAATTAAGTCTCCAGCTACTCTTTTGGCTA
AGACATCTTTGGTTTCTGCCATTTGCCCCAGTAATCCTCCACTGCCAAGTAGCACTTCAG
TGTTTCATTTGGACCCACCTGTCAAAAAATTGTTGGTTAGCCCAGAAGGAGCCATTTTGA
ATACCATAAATACTCCAGCATCTAAGGTTTCTTCACTCTCTCCATCTCTCTCTCAGATTG
TTGTATCTGCCAGTCGAAGTCCTGCGTCTGTCTTCCCTGCTTTTCAGTCGTCGGGCTTAG
AGAAGCCTGACAGAGCTGCATCTTGA
atttagactaaaagagccagtttttaaataatggggcattgttttgactcccataaaaat
tttcaatgtttattatactgttgaaagcatactatacattgtgtgtgtgtgtgtgtgtgt
gtgtgtgtgtgtgtgtgtgttttaatgtatcttttcattagcttgcaacaaggctttgtt

Predicted peptide sequence(s):


>KIAA2026_1|GENSCAN_predicted_peptide_1|798_aa
MEPAGEEERPPPAAEGEDDEEEVAAAAQTSGPAHGRSASSLEDADDQEEEMEAMVIGGGC
CKEQELTYELQQGYRILGEFLQEKHRGLTAPFLQPLGGVATAEEEVAEGPRSGGRGGRAF
PQQPGQGMCLLQMEEKFASGQYGGITEFVADFRLMLETCYRLHGVDHWISKQGQKLEMML
EQKLALLSRHLREKTTIAVTSRGYYGLEDEKGTACTSTRRRSTPRSLAGLTSGVFESIMV
QVLRQEEQLRAKEEKRASQNYSYYRKGGLMERGASQLVLTLAYQANCVSVSYTDLLGKPG
GSYFTFLYVLNIRSRLREQERKEAEEASQKEIEEWERKLLAQAAPTCMETMWEIPAIGHF
LCLAQQILNLPEIVFYELERCLLMPQCNAFLSKIMTSLLSPPHRRPTLHRRPTLPYRTWE
AALRQKVQQWYTAVGQTENPDNCAEKLGLCPQFFKVLGEVNPLEEKPFHELPFYQKVWLL
KGLCDFVYETQKEVQDAVLGQPIHECREVILGYDYLENAYVHFPQFCGADVRIYKQRPFQ
APEFPIPPIKIQRVPRIKLEKLKCDYVSTSNGEHRCSRDSLPSSFKKEQENNFDPACCPA
KMILDNHDISVEMGVKSNYEIRIRRPCEIKKTDCCKENLEKPRSPGEVTGFGEPLSPGEI
RFIENQEKYGEASRIKIEPSPLKENTLKSCQIHVNGSHSDHPEINCHKVVRDILLEQSLQ
SHKKLKLTKMRAKKKKKKKKKLKDVLNENLQRKREGLHSLAFKSYKPEIQNKLLIIKKKA
KHKKHKSGKLTQMDGSYI

>KIAA2026_1|GENSCAN_predicted_peptide_2|415_aa
MGIEEILTMGQICSNIYIPRADALRTEKNKSRRNSKHRPLARLIKKKREKNQIDTIKNDK
GDITTDPTEIQTTIREYYKHLYANKLENLEEMDKFLDTYTLPRLNQEEVESLNRPITGAE
IVAIINSLPTKKSPGPDGFTAEFYQRYKEELVPFLLKLFQSIEKEGILPNSFYEAIIILI
PKLGRDTTKKENFRPISLMNIDAKILNKILAKRIQQHIKKLIHHDQVGFIPGMQGWFNIR
KSINVIQHINRAKDKNHMIISIDAEKAFDKIQQPFMLKTLKKLGIDGTYFKIIRAIYDKP
TANIILNGQQLEAFPLKTGTRQGCPLSPLLFNIVLEVLARAIRQEKEIKGIQLGKEEVKL
SLFADDMILYLENPIVSAQNLLKLISNFSKVSGYKINVQKSQAFLYTNNKQRAKS

>KIAA2026_1|GENSCAN_predicted_peptide_3|1294_aa
MQRGKCNQSRASEEKCGNRQESERSRLKKDYDDFRRQPDHDTFNRELWTTDEGEGDLGKD
SPKGEISKSIDSTEPLDILEKDHFDSDDMKLSEIDFPMARSKLLKKELPSKDLPKTLLKT
LKRQSKQTDYVDDSTKELSPRKKAKLSTNETTVENLESDVQIDCFSESKHTEPSFPESFA
SLDSVPVSTLQKGTKPIQALLAKNIGNKVTLTNQLPPSTGRNALAVEKPVLSPPEASPIK
PALTCHTNTKGPLQMVYKMPCGQWLPIDLQNSSVKIQVQPMVDPKTGEKIMQQVLILPKN
FVIQHKEGKAVAKEVPPLQQKGTEQHCSSFPQTTNINSSLASVFVNSPGTVSTQLPNTAF
NKTITPLSNISSARPQPLSPVTSVSNLLTPSVKTSQSEAGKAKNAVSAATFSLPSASPTI
SSTGQPLSSTTTLNGSTNPGSSFNCFAQQTADSSEAKQELKTVCIRDSQSILVRTRGGNT
GVVKVQTNPDQNSPNTVSSSSVFTFAPQLQAFLVPKSTTSSSAFSPVAGTTTTSSLSPFS
QTPTSVSIPASFAPSMGKNLKLTLGHTTGSGDLGHVIDKTSHMPSSPLKSSICSSTLLPS
TTSSSVSVISISAANFGQNNANIIHTPTKQQQVDYITKSYPVTRSEATAATNGDVISGTP
VQKLMLVSAPSILSSGNGTAINMTPALTSTGVSAQKLVFINAPVPSGTSTPTLVAESLKQ
TLPPPLHKAYVKTPEQPQIVLIPSTVGTPIKINSSPAVSQIKDVKIGLNIGQAIVNTSGT
VPAIPSINILQNVTPKGEDKSSKGYILPLSTSGNSVPVSSNFVSQNITPVNESVVSSARA
VNVLSVTGANLSLGSFPVTSASASAGAQPPVLVSGNDTSSRIMPILSNRLCSSSLGNTVA
ISTVKTGHLASSVLISTTQPVVSPKCLTSALQIPVTVALPTPATTSPKIINTVPHSAAVP
GATRSVSISKRQSRTSLQFHSPGISTTVPTNVNTNKPQTELSSLSTSPGKITNTSNFASL
PNQQALVKTPSYSSAPGGTTIHTASAPSNVTSLVGSQFSEPCIQQKIVINTSTPLAPGTQ
IMINGTRFIVPPQGLGAGSHVLLISTNPKYGAPLVLNSGQGIQSTPIDNSAQKITLASNN
SLSGQPLQHPLRSPTKFINSFGNASSIPTVHTSPQLINTTAKVPVPPPVPTVSLTSVIKS
PATLLAKTSLVSAICPSNPPLPSSTSVFHLDPPVKKLLVSPEGAILNTINTPASKVSSLS
PSLSQIVVSASRSPASVFPAFQSSGLEKPDRAAS