GENSCAN 1.0	Date run: 17-Jan-104	Time: 01:20:13

Sequence INSL6_1 : 24150 bp : 39.77% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1217   1505  289  1  1   72   98   309 0.584  25.62
ggcgggaaagccttgacgcagccggcgcgcgccttcccttgaagttctggcgacgccccc
acgcgctcggaattccgcagtgtttgtgcgcgccgctcggcctggcgcaggcgcagacag
ggagcagggtccggccgaccgccattgcacaacgcggaggactagcctggggtcacaggg
ATGCCGCGGCTCCTCCGCTTGTCCCTGCTGTGGCTTGGACTCCTGCTGGTTCGGTTTTCT
CGTGAACTGAGCGACATCAGCAGTGCCAGGAAGCTGTGCGGCAGGTACTTGGTGAAAGAA
ATAGAAAAACTCTGCGGCCATGCCAACTGGAGCCAGTTCCGTTTCGAGGAGGAAACCCCT
TTCTCACGGTTGATTGCACAGGCCTCGGAGAAGGTCGAAGCCTACAGCCCATACCAGTTC
GAAAGCCCGCAAACCGCTTCCCCGGCCCGGGGAAGAGGCACAAACCCAG
gtaaaaatcgaaaccgaaggcatgtttgttcacctctgtatatttcttattcctgcattt
gctctgccagaaggtgagcttccccaggaagtggaatttgtgcctagtacacagctcttt
aaaaaattgtaaaaaacagtgtattgaaaatatacaaaacttcaatgaagcgcttttttt

 1.02 Intr +  22554  22640   87  1  0   74   91    69 0.002   4.82
aggaaaacactacacctactttagttaaatattgcttttgaataaccatactttccattc
tttatttaaaatgtgattacttgttttttaataattagctgattttactgttccaatatt
aaattttcatctaaaggaagattttaataaaggagcatttattttcttctctctcaacag
TGTCTACTTCTTGGGAAGAAGCAGTAAACAGTTGGGAAATGCAGTCACTACCTGAGTATA
AGGATAAAAAGGGATATTCACCCCTTG
gtaagacaagagaattttcttcatcacataatatcaatgtatatattcatgagaatgcaa
aatttcagaagaaacgtagaaacaaaattaaaaccttaagcaatttgttttgggggcatc
atccccaaagaaaacgcagaggatattcagaaaagtgttgtcttacaggatgtacaaaag

Predicted peptide sequence(s):


>INSL6_1|GENSCAN_predicted_peptide_1|126_aa
MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETP
FSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKK
GYSPLX