GENSCAN 1.0	Date run: 17-Jan-104	Time: 01:58:14

Sequence GALNT12_1 : 43793 bp : 45.66% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1571  371  0  2   41   68   633 0.137  51.07
ccctgccgaaatgagccaccccgggggctgcgcttgggctggcgcggggctggacggaaa
gggggcggcgcgcaggtggggcgggccgggggcggggcggcacggcggttccgggatccg
ggtcctggcctccaccgccgccttggggcgcgcagatcgctggctgcagttggcgggcgc
ATGTGGGGGCGCACGGCGCGGCGGCGCTGCCCGCGGGAACTGCGGCGCGGCCGGGAGGCG
CTGTTGGTGCTCCTGGCGCTACTGGCGTTGGCCGGGCTGGGCTCGGTGCTGCGGGCGCAG
CGTGGGGCCGGGGCCGGGGCTGCCGAGCCGGGACCCCCGCGCACCCCGCGCCCCGGGCGG
CGCGAGCCGGTCATGCCGCGGCCGCCGGTGCCGGCGAACGCGCTGGGCGCGCGGGGCGAG
GCGGTGCGGCTGCAGCTGCAGGGCGAGGAGCTGCGGCTGCAGGAGGAGAGCGTGCGGCTG
CACCAGATTAACATCTACCTCAGCGACCGCATCTCACTGCACCGCCGCCTGCCCGAGCGC
TGGAACCCGCT
gtgagtgcacagctctggggaggaagcccgccctcagagccccgggcctcagtttctcca
tcagagcagtggcagggcggggagctggggtctccaggatggcgcgtcttattgagtctt
tctccgaagacgatagtgtaagagctcacatgggggcggggaggcaagaaagtaaaaaag

 1.02 Intr +  16758  16927  170  0  2   86  105   108 0.523  11.89
gttaggacctttcttggagtctgctggggctcctagtgccacaaggggagctctggaaga
tccttcagtggattatgtccccttccgcaggggaccatgacctatgtcccctttgtcact
ccatccccagtgccagcctgggctagatcctgagttcctgaagttccgctgtatttgcag
GTGCAAAGAGAAGAAATATGATTATGATAATTTGCCCAGGACATCTGTTATCATAGCATT
TTATAATGAAGCCTGGTCAACTCTCCTTCGGACAGTTTACAGTGTCCTTGAGACATCCCC
GGATATCCTGCTAGAAGAAGTGATCCTTGTAGATGACTACAGTGATAGAG
gtgagtcccggccagggctctgggaagagcctgtccttctgtagcagtgtctgggaggtg
agagtgggatgcaggagggctaaagtaggcccagtaaggatgggcttcctgtatcctcct
gtacccaaggaagacctcagggatagtagcccagaaacagtaggcgtgggaaactggaag

 1.03 Intr +  17818  17985  168  2  0  114    1    64 0.500   0.22
cctctgtgtgttctaataggtgtgtgcattgggctgttttcacagactcaatagtgactc
acacaagatagaaacaggcttctcacatcacaaatctggtgtgctagtctagaatgggtg
tggtggctccttggtggatggggcctcagctccttctgcacctgttcccaccttctctag
GGTGCTCTGCTGCCTTGGTCCTCATGGACCAGGCTGGTTTTTCACCTCCTACTCACTCTG
GTCAACCAGAAGACTTAAAGGGGAAGGAGAGCCACACCCTTCCTCCCGAGGGCACTGCTT
GGAAGTTCTCCACACATCCCATTGAGCAGAGCGTGGTTGCCTGGCCAC
gtgtagctgcaagggaggctgggagctgtggcctttatcctgctggctgtgtgttcagtt
acaggtcacagggagaatgggtttaaggcacaaggagcagtgtctgtgacagcgtgtaag
ccaggctggggtaagccaggctggggtttggtgctgactatagcctagaaggcattgggt

 1.04 Intr +  20254  20443  190  2  1  113   94   221 0.833  23.84
cggagcacttccaaccttggttctgggtgaggtaaggatgtcccaggtggcagagcaaag
gaggctcctgtctatttcatcttctgtttgggacagggaggcccagaaggccccgggttg
ggatgaggcgctcctccgagattgtcacggtgacccctgttgctttgtttgcctccctag
AGCACCTGAAGGAGCGCTTGGCCAATGAGCTTTCGGGACTGCCCAAGGTGCGCCTGATCC
GCGCCAACAAGAGAGAGGGCCTGGTGCGAGCCCGGCTGCTGGGGGCGTCTGCGGCGAGGG
GCGATGTTCTGACCTTCCTGGACTGTCACTGTGAGTGCCACGAAGGGTGGCTGGAGCCGC
TGCTGCAGAG
gtacgtgagccgcccaccatgggagagacagcatgttacctggagtaggtagcatgagga
acagactcatcacgtcacttgagggttaacgggttgcctgggctcagctgcttctctgtc
actgggcaggagagcagtccctgcttagttcggctgttgagaccgttaaatgatttagtg

 1.05 Intr +  24044  24134   91  2  1   42   41    77 0.348  -1.60
ttttgtgtatcagggaggccaagtatcctgcagatcagccctgttcagtggagaatggtt
ctggcccagatgccaatagcatccctgtgggtcctgcacattctccagccacgactggga
gtcctatactccaatgctggtacagcattcccctagttttcccctccttgtaaaaattag
GCTTTCTGTGGTTCCAGCCAGCTTGATCACAAGCCATCAGTTCCTGGGGGAGCTGGCCTT
TGCCAGGGGCCAGCTAGAACTTGCCCAGCAG
gtctgatgttggccctttcaaccttttaaataatgccctcaattgctttaaataagcgga
tgttggtggatacctagtatgcaacttcctcaatttggggaactcacagatctaagaccc
tgtctcacgcaacctgttctgaacagtgcaatttcccgatagttgtaattcttaccccag

 1.06 Intr +  25242  25459  218  2  2   68   71   323 0.686  25.90
aagccctccgtggcccccagatctcccccatggtggtcacctgccagggctctgacacgg
ctgcagacacctggaataagagaagcaggtctttctcagatgttcctccctcttattgga
aggaagacaagaattcacccttgaatttcccaattgtcttcctgctgcccgtctgcatag
GAGAGACGGATGGATGTCTTGGGTGCTTTCAGGATCCATGAAGAGGAGTCGGCAGTGGTG
TGCCCGGTGATTGATGTGATCGACTGGAACACCTTCGAATACCTGGGGAACTCCGGGGAG
CCCCAGATCGGCGGTTTCGACTGGAGGCTGGTGTTCACGTGGCACACAGTTCCTGAGAGG
GAGAGGATACGGATGCAATCCCCCGTCGATGTCATCAG
gtcaggagctgacttctgggtgacttgttttttaagcatgcctcattgaatctggctgac
ctgtgagcggaggccctcgggaggaatggttagctgtcagcttaactacctcccctcttc
ccacttttttgcccagagtatttgtttatttttattaaacgtgtctgctacacatgtcaa

 1.07 Intr +  28751  28868  118  2  1   52  110    -2 0.481  -1.13
gggaccgtagggtacatctatgcctccaggcccagcctagtgtggggcacagaggtgaag
gcgggatatgcttagagatgacagatgaacagatgaaagggctcgtggtgggaaggtagt
tggataactgtgatggttttctgctgtctacagtgaaataaggatatcatacttttttag
GTCTCCAACAATGGCTGGTGGGCTGTTTGCTGTGAGTAAGAAATATTTTGAATATCTGGG
GTCTTATGATACAGGAATGGAAGTTTGGGGAGGAGAAAACCTCGAATTTTCCTTTAGG
gtaagtatttcagtcttctctttggacatgttcttaactgattctctctttgggaacgat
gggatttgctgtaagagcctggtggaccctgaaagatgatgacacgcatatcctataaac
atgcttgctttcttgttttagctttttaaaaagtgtactttttctagatttggggccagc

 1.08 Intr +  30474  30650  177  2  0  114   97   119 0.855  15.52
tctttacccacattctgtgtcatgagtgtgccgggtaggtggcctcctgcccgatggagg
ctgagcatcttggcagtgtccatcatgccttgcgtgtgcctggcctctttgctgcagata
ctatggacccgcagctcatcccctgctcaccacctggcctctccttttctctgtgtgcag
ATCTGGCAGTGTGGTGGGGTTCTGGAAACACACCCATGTTCCCATGTTGGCCATGTTTTC
CCCAAGCAAGCTCCCTACTCCCGCAACAAGGCTCTGGCCAACAGTGTTCGTGCAGCTGAA
GTATGGATGGATGAATTTAAAGAGCTCTACTACCATCGCAACCCCCGTGCCCGCTTG
gtgagttcctcggcccacctgcactccatctggcttcatctgaacaacagcagctaatcg
tggcttccccaacatagtcgatctggttccagaaatagagaataaattgggtgctcagat
acgagtaaggggagaatttattcctccatttataataattatatgcagtcaaatcttctt

 1.09 Intr +  33377  33421   45  1  0   82   83    31 0.602   0.61
agccccagggcttggctccttcactccatcagcaggcgggttgtcctctacccttgtgca
cctggtcacacccccctgccaacagagcacctaggaatggaattgtctgtgtgacagcct
ctcatactagaagctagaattaggtgcaaggatgttttctatcctctgtgctccacacag
GGCCTGGCATGCGACGAATGCTCCATCAAAGCTGGCTGGTGGTTA
gtaagtgagcatcagtgaacacaggggctttgaaaggaagcactaggacccatggggtct
cactgttttgttgttttctcaggaaccttttggggatgtgacagagaggaagcagctccg
ggacaagctccagtgtaaagacttcaagtggttcttggagactgtgtatccagaactgca

 1.10 Intr +  33504  33635  132  2  0   95  101   160 0.999  18.84
tagaagctagaattaggtgcaaggatgttttctatcctctgtgctccacacagggcctgg
catgcgacgaatgctccatcaaagctggctggtggttagtaagtgagcatcagtgaacac
aggggctttgaaaggaagcactaggacccatggggtctcactgttttgttgttttctcag
GAACCTTTTGGGGATGTGACAGAGAGGAAGCAGCTCCGGGACAAGCTCCAGTGTAAAGAC
TTCAAGTGGTTCTTGGAGACTGTGTATCCAGAACTGCATGTGCCTGAGGACAGGCCTGGC
TTCTTCGGGATG
gtgagtgagggtggtgggcccacggcaggcagggacttccctggcctctgggtctgctct
gcaaatcctgggcaagaaaggccacgtcatggggagcactggcttcctccactcccaccc
gcctgcccaccccccaccacctttttatccactgcccttctttctccctgtgagcgtctg

 1.11 Intr +  37598  37711  114  1  0   54   96   110 0.882   9.04
cctgcagaacaaggaagcacttttaaagctagaaggtgctgtacagaaaagactcttacc
tttgcgtctagctcttgaagcaggctctcctctcatgccaggtaccctccccaagccttg
tgtggcatctgttagtgtctataaatctggactgaaatgccacatttatgttttatttag
CTCCAGAACAAAGGACTAACAGACTACTGCTTTGACTATAACCCTCCCGATGAAAACCAG
ATTGTGGGACACCAGGTCATTCTGTACCTCTGTCATGGGATGGGCCAGAATCAG
gtaggtatgagcctcaaaagaggagaaagctgtgtgttttgttaaaaaaattaaatagtt
gaatttttttcttgtaaaagtaatatttgggaaatataaaaagtagaagcctagggtggc
cagactcagagagaccactgttaaaattaaaatgtgttttcttcccatcattttttacac

 1.12 Intr +  39479  39625  147  1  0   44   92   171 0.989  13.53
gtagcggttcactgagggctgtgggatgcggaggaacccatcacacaggctcgtgttggt
ggtgacgcaggtgcatgaccccacccatgctctcgtgatcccaggttcttgtccagcgat
ctttcctcttcccacatcagtggaaaatgttgtgttacatgttggctgccccatttttag
TTTTTCGAGTACACGTCCCAGAAAGAAATACGCTATAACACCCACCAGCCTGAGGGCTGC
ATTGCTGTGGAAGCAGGAATGGATACCCTTATCATGCATCTCTGCGAAGAAACTGCCCCA
GAGAATCAGAAGTTCATCTTGCAGGAG
gtaggtgaactctctccttccttcctgctgacagtccctgggctataagggagagtgtga
gagtcagacgttctctctggcatagtcctggtgaggatcagggatgtggccatgcatgga
caggagctctggaagacctggaacctcagtcccagtgagcctggggggcggtgatggcag

 1.13 Term +  42454  42594  141  0  0  112   48    74 0.877   3.73
gtacaagcctggtgctgtgtccccgggacagtcctgagttgctgcgttacacggaagaca
cttacccctcaataaatatttctgaaatggtaaaaatcagaccctgatctctttaaaaca
tgtctttaggaaaaagagacttttctgatgacttgcctgtcattctgttatcttttgtag
GATGGATCTTTATTTCACGAACAGTCCAAGAAATGTGTCCAGGCTGCGAGGAAGGAGTCG
AGTGACAGTTTCGTTCCACTCTTACGAGACTGCACCAACTCGGATCATCAGAAATGGTTC
TTCAAAGAGCGCATGTTATGA
agcctcgtgtatcaaggagcccatcgaaggagactgtggagccaggactctgcccaacaa
agacttagctaagcagtgaccagaacccaccaaaaactaggctgcattgctttgaagagg
caatcattttgccatttgtgaaagttgtgttggatttagtaaaaatgtgaataagctttg

Predicted peptide sequence(s):


>GALNT12_1|GENSCAN_predicted_peptide_1|693_aa
MWGRTARRRCPRELRRGREALLVLLALLALAGLGSVLRAQRGAGAGAAEPGPPRTPRPGR
REPVMPRPPVPANALGARGEAVRLQLQGEELRLQEESVRLHQINIYLSDRISLHRRLPER
WNPLCKEKKYDYDNLPRTSVIIAFYNEAWSTLLRTVYSVLETSPDILLEEVILVDDYSDR
GCSAALVLMDQAGFSPPTHSGQPEDLKGKESHTLPPEGTAWKFSTHPIEQSVVAWPQHLK
ERLANELSGLPKVRLIRANKREGLVRARLLGASAARGDVLTFLDCHCECHEGWLEPLLQR
LSVVPASLITSHQFLGELAFARGQLELAQQERRMDVLGAFRIHEEESAVVCPVIDVIDWN
TFEYLGNSGEPQIGGFDWRLVFTWHTVPERERIRMQSPVDVIRSPTMAGGLFAVSKKYFE
YLGSYDTGMEVWGGENLEFSFRIWQCGGVLETHPCSHVGHVFPKQAPYSRNKALANSVRA
AEVWMDEFKELYYHRNPRARLGLACDECSIKAGWWLEPFGDVTERKQLRDKLQCKDFKWF
LETVYPELHVPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFF
EYTSQKEIRYNTHQPEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCV
QAARKESSDSFVPLLRDCTNSDHQKWFFKERML