GENSCAN 1.0	Date run: 17-Jan-104	Time: 03:24:43

Sequence EDF1_1 : 6567 bp : 59.11% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    972   1145  174  0  0   48   40   164 0.766   7.86
gcaaaacaaaggggggcggccgcacggctagagcggagaccccgcgccccctccgcccgc
gtggcccggccggggtgcggggcccggggaggcacgggggctgcgcgtcggggcgcagcc
gccgcccgcgtgtgctcggaggccgcggggcccgggctccggggtcctcccgacctgcag
CCCCAGCGGCTACCGCGCCTCGCCAGGCCAGGCCAGGCCCCGACGTCGCCTTCCCTACGT
CGCCGGCGCCCGGCCACGACGTCCCTCAGACGAGCCGAACGCCGAATGGCCCCGAGCACG
GGAAGTGCCCGCCCCCCGCGTGCAGCCAGCCAATGGGACGCCGAAAGCGGGGAG
gtgccgaggggacgtagcgtcgccgcgccaggtctctagcagctgccgctgagccgccgg
acggacgctcgtcttcgcccgccatggccgagagcgactgggacacggtgacggtgctgc
gcaagaagggccctacggccgcccaggccaaatccaagcaggtgctttgctgactgagga

 1.02 Intr +   1177   1306  130  1  1   19   49   255 0.920  16.57
ggccaggccaggccccgacgtcgccttccctacgtcgccggcgcccggccacgacgtccc
tcagacgagccgaacgccgaatggccccgagcacgggaagtgcccgccccccgcgtgcag
ccagccaatgggacgccgaaagcggggaggtgccgaggggacgtagcgtcgccgcgccag
GTCTCTAGCAGCTGCCGCTGAGCCGCCGGACGGACGCTCGTCTTCGCCCGCCATGGCCGA
GAGCGACTGGGACACGGTGACGGTGCTGCGCAAGAAGGGCCCTACGGCCGCCCAGGCCAA
ATCCAAGCAG
gtgctttgctgactgaggagcggccgggccgggcggggcggacgctgggccggggccacg
gaccgtggggcagggggctcggggaagggcaggcggggcctgggacagggcgcaggggac
ggggacaaggctggggtgccgggggcaggacggggttcgaagggcggggcgaatcgcagg

 1.03 Intr +   3616   3667   52  0  1   87   51    33 0.480  -0.88
tacaggcataagccatggtgcctagttgagcttaggtaactgaacccaggactgcatatc
agtccttgggcaccactagtccttagcagtgtgctaactggctaacagcaggcctgaatt
ggtgtgtgctggatactgtcaaagctaattttgatccactgatgttttctaattttctag
GCTATCTTAGCGGCACAGAGACGAGGAGAAGATGTGGAGACTTCCAAGAAAT
gtaggtacttgtgtttccgcttgcaacatgaggctgtgctgtggggtccatgtgctggtg
ggtgtggtgtgtgcggcgcccccggggacgttgtcagctgagtgcctgcctgcaccggtg
ctggccggagccctgggaggcagccatcttcccagagcagctctggttggcatgagtaca

 1.04 Intr +   4039   4199  161  2  2   56   89   175 0.856  15.30
tcataactgagagaaaactctggaagtccacgacctgaggtgtgtgaacttgggacagcc
tgggttcccatgtccccttgagttcaggcagcctctggggtctggttaccgctttgaaat
ggtttttcttcaggttaattccaaatcctctcctctgcttttgcctcacaccgactccag
GGGCTGCTGGCCAGAACAAACAACATTCTATTACCAAGAACACGGCCAAGCTGGACCGGG
AGACAGAGGAGCTGCACCATGACAGGGTGACCCTGGAGGTGGGCAAGGTGATCCAGCAAG
GTCGGCAGAGCAAGGGGCTTACGCAGAAGGACCTGGCCACG
gtgaggctgcgccggggctctcactcctggggttgtgggtttggggagggggatggccgg
tgttcagatagcacggggagggtgggctccacccccctggttcccctgcagggaatgcct
cgggaagccaggtcagcccggctctcactgcctctcgcacaaaacccagctgcgtgtggg

 1.05 Intr +   4488   4581   94  2  1   52   97   136 0.728  11.60
cagggaatgcctcgggaagccaggtcagcccggctctcactgcctctcgcacaaaaccca
gctgcgtgtgggtgcgtaccccaggggccctagaagctgctgttctcaggcgacgcttcg
cgcctggttttgcagcagtcctagtggagctgatgtgtataaagcacatcttctctttag
AAAATCAATGAGAAGCCACAGGTGATCGCGGACTATGAGAGCGGACGGGCCATACCCAAT
AACCAGGTGCTTGGCAAAATCGAGCGGGCCATTG
gtgagtgtccctccacccttcgccgggtccgctgaacagggaggctacccgctcccagct
ggggttggtgagagtgggactcgggggaagaagatggccctgggggtcccctgttctctg
aattctggagctttgcttctccaggtagtacagactgagggatggtggggtctctgcagg

Predicted peptide sequence(s):


>EDF1_1|GENSCAN_predicted_peptide_1|205_aa
XPSGYRASPGQARPRRRLPYVAGARPRRPSDEPNAEWPRAREVPAPRVQPANGTPKAGRS
LAAAAEPPDGRSSSPAMAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKW
AAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQ
VIADYESGRAIPNNQVLGKIERAIX