GENSCAN 1.0	Date run: 17-Jan-104	Time: 02:51:39

Sequence ECM2_1 : 43053 bp : 38.92% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1162   1238   77  2  2   78   98    40 0.198   2.32
ttatgattaaaaaaaatatttcccttggtaaccattttccctggttactttcttggctga
ttttctgcacaaagaactgaaaggcatttatccccaagggaggcagttattttagatttt
actaagaagttcagcaaatacttttcaacattcccttctgtcctttctttgtttttaaag
AAAGCTCTGATTTTGTTTCATTTTCAGCTGGAGACTTAAATGACACCAAGCAAAGCCTAC
TTAGTTTAGATCTCCAG
gtaaaaaagttttaaattttaagtttctacttagcatgtggaatggttttaatatttggg
tattttatttcacaactgtttaactcttgagtaaattagctcgttactaatagattttta
aagttcaaagtatgcattattctgtttgtttttttcacgatgtacttcccaagtatttca

 1.02 Intr +  13724  13906  183  1  0  122  116    81 0.987  13.36
ctgcctccctttcactgtttcgccctaaacatctgcttcttagatctaagtgattgtact
caataaatcgtgtggagaccagaactctgggccttttgcagcctccattgtgcaactggc
cccctggctcccatctttatgaactcttaacctgtctcttctcttcctttgttgccacag
GGCTTTGGGTACCCTATGGGTGGTGTTGAGGCTGGTCCCCAACATATTGTCTATGGCTGC
TTTCATGCTACAATGACAGAGCTGAATAGGTATGACAGAGAAGGTGTAGCCTATGACGCC
TCAAATATTTACTATCTGGCCCTTTATAGAAAAAGGTTTCTAATTCCTGGTCTAAAGATA
AAG
gtaagatacaaaaaagttctgaacaggcatggtgactcatgctgtaatcccagcactttg
ggaggccaatgcaggaggactgcttgagcccaggagttcaaggctgcagtgagtcatgac
tgaaccactgcactccagcctgggcgatggagcaagaccccatctctatttaaaaaaaaa

 1.03 Intr +  14278  14596  319  0  1   77  110    26 0.754  -1.69
tgattctgatagaagaattccaaattatgatttggcaataatactatagcatatagtcca
tatatcataagtgtaatttctcaaagacttgcctactgaggcatacaagcaaatatataa
gccaattttcagaagtaaaaatttagtcaccactaactttgaaatattgtttcattctag
AAATTGGCTGGTGGAAAAAAATCAAACATGAAGATTGCAGTTTTGTTTTGTTTTTTTCTG
CTTATCATTTTTCAAACTGACTTTGGAAAAAATGAAGAAATTCCTAGGAAGCAAAGGAGG
AAGATCTACCACAGAAGGTTGAGGAAAAGTTCAACCTCACACAAGCACAGATCAAACAGA
CAGCTTGGAATTCAGCAAACAACAGTTTTTACACCAGTAGCAAGACTTCCTATTGTTAAC
TTTGATTATAGCATGGAGGAAAAGTTTGAATCCTTTTCAAGTTTTCCTGGAGTAGAATCA
AGTTATAATGTGTTACCAG
gtaagagaacactatgagagagagacagaaagagggaggagggtgagagatggtatgggg
aaagagaaggagagagggagagagggagaacatctccatgaagataattttctaaagaaa
aatccaggttattatattactttttggtttaatctacaaacatacattttaaaataattt

 1.04 Intr +  19296  19484  189  1  0  114   52    53 0.440   2.94
ctgtgaaaagcatttcagcatttcttatgtctatacgacatctttaccctatacatgaat
gcacatagaattctattcttgtgtggttagagcagtttgacttcacattgtgtttacttc
cattcacagttactgataatcacataagaaatttaaatttgtgcttttgttttcttctag
GAAAGAAGGGACACTGTTTGGTAAAGGGCATAACCATGTACAACAAAGCTGTGTGGTCGC
CTGAGCCCTGCACTACCTGCCTCTGCTCAGATGGAAGAGTTCTTTGTGATGAAACCATGT
GCCATCCCCAGAGGTGCCCCCAAACAGTTATACCTGAAGGGGAATGCTGCCCGGTCTGCT
CCGCTACTG
gtacagagatttagctaagcaaaatatcagtgtgtgattaatctttaacttccatttgtt
tttgttactaattttagattaaaattatgatacattagtcagatctgagtacttaaaata
ttggcaaaatgctgattaacatagaaaatatctgggaaaatgtatggtaggggatataaa

 1.05 Intr +  22034  22540  507  0  0   43   99   607 0.203  49.32
tgcactcaaatacttggagggaataatatttactaacctcattttcattatggttttttc
ttttattaatatcatcaacttatctctgctacctcatccttgcgtggtcattagtctcct
attctctactcagtggtatagcattaaatgatagaaatgaattttctggtgattcttcag
AACAAAGAGAACCTACCAATTTACTTCATAAGCAACTGCCACCTCCTCAGGTGGGAATGG
ACCGAATAGTAAGAAAAGAAGCACTTCAATCTGAGGAGGATGAAGAAGTGAAAGAAGAAG
ATACAGAGCAAAAGAGAGAGACCCCTGAATCTAGAAATCAGGGGCAACTTTACAGTGAGG
GGGACAGCAGAGGAGGAGACAGAAAGCAGAGGCCTGGAGAGGAGAGGAGGCTGGCACACC
AGCAACAACGCCAAGGAAGGGAGGAGGAGGAGGATGAGGAGGAGGAGGGTGAGGAGGGTG
AGGAGGATGAGGAGGACGAGGAGGACCCGGTAAGAGGAGATATGTTCCGAATGCCCTCTC
GATCCCCGCTTCCTGCTCCTCCCAGAGGCACACTGCGCCTGCCAAGCGGGTGCTCTCTGT
CCTACAGGACCATCAGCTGCATCAACGCCATGCTTACCCAGATACCACCGCTGACAGCAC
CACAGATAACAAGTCTGGAGCTCACTG
gtaagagatgttgacttctgctttattttgtgctttaaaagtaaatgactcttagcagct
gggcacggtggctcacgcctataatctcagcactttgaaaggctgaggtggccagatcac
ctgaggtcaggggtttgagaccagcctggacaatatggtgaaaccccatctctaccaaaa

 1.06 Intr +  23903  23986   84  0  0   73   64    53 0.263   0.27
tgcccaggagtgggactgcggatatggtaaatacatgtttaagtttataagaaaatgccc
cacagttctctaaagtggctgttcctttcccacctgcatgctggggagctcctgcctctc
tgcagcctgcccgcacttggtactgtcagttgttttctcccttcctttttgacattctag
AGGGAATGTGGTCATCTAGACCTTCTGCCCATGTTTCCATAGGACCACCAGGGAGGGCTC
TGAGTGGAACAACAGCAGGACCAG
gtgtgagaggctggctggtggggacactttgggtgctgggagcagcaggagcattcgtct
gggtaatgaggcccccatgccacgggtgtccctggagatgctggggtgagggaagctgaa
aaggtcaacacatttgtgcagagatggccatctgtgacagcacactgccagtgtcaaaca

 1.07 Intr +  25045  25160  116  2  2   70   94    66 0.896   4.65
ccagcttgttacttttctgaacatgctttggttatataatatatattctgtccttgttct
gagtattgctttctcctccagacaaagctctctcttgatatctatgcacacatgcccata
catgtgtgtacatgtatgtatatgcacacatgcctaaaacataaccgctgtgtgtcctag
GCAATTCCATCGCCTCCATCCCAGATGAAGCATTTAATGGATTACCAAATTTGGAAAGGC
TTGATCTGAGTAAAAATAATATCACTTCTTCAGGCATAGGTCCAAAAGCATTCAAG
gtaaatacatgctctgatttgtctatttggatgaatggcttcactatgacttgcattggt
tggagatggggaagggaggaaaaggaaaatgcttctaattggtagtcttcttctaagaaa
gtttcctctctgatgtccctaatttgaattcaagttttcccttgaatatagtttactatt

 1.08 Intr +  27137  27272  136  1  1   17   68   144 0.782   4.52
attaccaggatcaatatcaacctggcagggggaataaggggtttgctgtgtggcctggac
attactgtctaagcctaaggaaggataggtttgtgagacttttagtcacgaccattatat
gaaatgtgactgcacagctgtgactagataaaaaagtaactttgagatttgctttttaag
CTTCTGAAGAAGTTAATGCGTTTGAATATGGATGGAAATAATTTGATACAGATTCCTTCA
CAATTGCCATCTACATTAGAAGAACTTAAAGTCAATGAGAACAATCTTCAGGCTATCGAT
GAAGAAAGTTTATCAG
gtatttaatatttgtttttcaatgatatgcttccttataatctttcctatatagtcctgt
agaaattttatttactgtattgccaaatgaataaatagtaaatatttttaggtcacttaa
ccatttgagttgataaaacttcttttaactattgactggtaaaacgtaaaatgaatttta

 1.09 Intr +  28853  29041  189  0  0   90   40    80 0.328   2.04
gagatgttataaaacatgcactcctgattgtgaacgtgctttcacacacccctggaactg
ccttccagagtactcttctcctccctcactcacaaatgcttctagattcccagagtgttg
acaggaagccagggtgaacgggctgtctgcctgcctttcttagcccacctttctccacag
TCCGAGCACCCGAGGAGCCTCGGCCCCATGCCGGCAGTGCTTCTGTCCTCCGGCTCAGAT
ACCCCCGGCTGCACTCCCTGGGTGGGCTGAGTTCTAAGAGCTACTGCAGTACTGGCCCCT
CGGGTGCTGGGCTCCCCCTGGCTGGGAGTCCTGATGCTGTGGATGGTCAGGCTGGCTGCC
AGGAGTGCT
gtgagggcaccctgcttctgtgtggaagcaggtggcccactgctctcccgtcatctctct
tggggtggctcctcactcatgacctttcagattatagctccagagagggggaaggagggc
actccagggagagaaaacagcacaaagatgcaaataaatgagacaatttgggatactgtg

 1.10 Intr +  29139  29567  429  1  0    9   36   241 0.160   3.76
cagtactggcccctcgggtgctgggctccccctggctgggagtcctgatgctgtggatgg
tcaggctggctgccaggagtgctgtgagggcaccctgcttctgtgtggaagcaggtggcc
cactgctctcccgtcatctctcttggggtggctcctcactcatgacctttcagattatag
CTCCAGAGAGGGGGAAGGAGGGCACTCCAGGGAGAGAAAACAGCACAAAGATGCAAATAA
ATGAGACAATTTGGGATACTGTGGGAGCTGCAAGCAGGCACGGTGAAGGTGAAAGGCAAG
CAAAGAGCAGCACAAGGGGCTGCACACACCTTGCTGAAGGGCAGGGAATTTACCTGCAGG
AGGAGCAGAGTCCACCTGAGATGTGCACACGTGTTATGGAGAAAGGGAAGGACTTACAAT
TGAGAGAGAGGTGTGAAAGGTGGAGGGAGGGACAGCTGAGGAAAACCAGGCACGCTTTAA
AAGCATTTTTGTTGTCACTAATGACTGAAACAACTAAATCAGGAGCCCTGGAGGCTGCTC
TAGTGGATGACCATGTGATGCTGCCTGCCAGGAACATCGAGGCACCTGCCATGTCCACAG
CCTGTCATG
gtaccacccaccatggaagacttcctgtttcctgtccatgaatcctttcaacatccacct
caagtctcacctacaagaaacgttctctagctccatcctatttcctgttacctcctattt
cctatatataccagagaataattgcaaaagaaaacacagtgtcctgaatttgcactgttt

 1.11 Intr +  31481  31638  158  0  2   78   77    96 0.967   6.31
tgagcatctgggatgtacaaagtacttaagaaaaggttttataggaggatacaaaggttt
aaaaaaaactgtatttgccctccaaataaaccggccatttcacatgacatttcaaaaggc
tacaaaaatttgcatggtttttcaattatcctaatattctaatacttttattttttatag
ACTTAAATCAGTTGGTCACCTTAGAATTGGAAGGAAACAATCTCAGTGAAGCCAATGTCA
ATCCTTTAGCTTTCAAACCTTTGAAGAGCCTAGCCTACTTGCGTCTGGGAAAAAATAAAT
TTAGAATTATACCGCAGGGTCTTCCTGGTTCTATTGAG
gtaacaatatatttttttagtgttttaaatgtattatatttgaaatatggtacactacaa
caaaatatattttaagactattgtgatgtaaattaaactctagtttcatgctgtatacag
aatttcctgtaatttaagcattgttttttcttcaagcaatacaaaattctgaatcgaaat

 1.12 Intr +  33151  33327  177  0  0  113   69    14 0.616   1.19
agatatgctaagtcagattctttgtgggacagggccagaaatgaataattaaaaaattaa
aatttaaatagataatgcatacacatgttaaaacacatacatacacaatgaggataatac
aaaagagcaatctgccccactgtgagcctgagcttcccatactgacttctctctctccag
AGGGATCCACTCCTACCAGTCTGGAAAGCACTGGGCATACAAGCGCACAAATGCGTGGCA
CATACTACAAATCCTTCTAAAGCCACTGCTGTACACCTGCCTCACTTAACCATGCAGCCT
CAAGGCTGTCTCATGTCATTCTTTCCTACAGCTGCAGAGTTTTCAACATATGGACAG
gtgtgccaggatttatttgactagtctcttactgatctagctcacctcctaaatacatat
gcaggtaaaagcaaaaagttgaaaattgttttactaatttctaacaaataccaaaattaa
caaagagggaaattctcacaggtggaatagaaggtgacactaaagatatatgccagtttt

 1.13 Intr +  34519  34658  140  0  2   62   89    45 0.931   0.34
ctgtctcaaaaaaaaaaaaaaaaaaaaagacaacttaaaaatatgagcttacttgaaaga
gcagtaagactctttagataatactaatgataatagtctatgtcactattttagtctcca
tgaaattgaacgtatcaactaacacaaaagaaaaataatagtcttctctcttaattatag
GAATTATACCTAGAAAATAACCAAATTGAAGAAATAACTGAAATTTGTTTCAATCATACC
AGAAAGATCAATGTCATTGTACTACGTTATAACAAAATTGAAGAAAATAGGATTGCTCCT
TTAGCCTGGATAAATCAAGA
gtaagtacatgctacaatttaaattttattgaactatttcttcctctcgctattattaaa
cagagtatggaaactgggaatgggataagtgagggaggtgacgatactgaagggctcgga
gacagaatcgtttcttagtgaacccttaccctatccccaaagtgggctacttcatgcagt

 1.14 Term +  36118  36448  331  1  1  104   32   189 0.928   8.04
gcagcttggtgcaagagactagggctggctatacctggaaaagttcctatttggaatcat
cactacaaactgggtgcttataggaaaatggaccagcatcgagactggccttatcaaaat
ttagagctgatgatcaccatcctgatgtccctaccctgtttacttttttctttgctgcag
AAATCTAGAATCCATTGATCTCTCCTACAACAAGCTCTATCACGTCCCGTCCTATCTACC
CAAGTCCTTGCTGCACCTAGTACTCCTTGGGAACCAGATTGAACGGATCCCTGGCTATGT
GTTTGGCCACATGGAACCAGGCCTGGAATACTTGTACCTGTCATTTAACAAACTTGCTGA
TGATGGCATGGACCGTGTCTCCTTCTATGGGGCATATCATTCTCTGAGAGAATTATTTCT
GGATCACAATGACTTAAAATCTATACCACCTGGGATACAAGAAATGAAAGCACTACATTT
TCTGAGGCTGAACAACAACAAGATACGGTAA
attttggctttttcaagtatctgtttaaattttggttggcaaaatatatgataaaacaac
catgacatgatctctgggatttacgttaagggaaaaaaaaatggtgctaaggggttggat
taaacaagattggcaaatgttagtaattaccaaaggtggatgacaggtatgtgaggattc

Predicted peptide sequence(s):


>ECM2_1|GENSCAN_predicted_peptide_1|1011_aa
XSSDFVSFSAGDLNDTKQSLLSLDLQGFGYPMGGVEAGPQHIVYGCFHATMTELNRYDRE
GVAYDASNIYYLALYRKRFLIPGLKIKKLAGGKKSNMKIAVLFCFFLLIIFQTDFGKNEE
IPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTVFTPVARLPIVNFDYSMEEKFESFS
SFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEPCTTCLCSDGRVLCDETMCHPQRCP
QTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQ
KRETPESRNQGQLYSEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDE
EDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQIT
SLELTEGMWSSRPSAHVSIGPPGRALSGTTAGPGNSIASIPDEAFNGLPNLERLDLSKNN
ITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELKVNENNLQAIDEESLSVRA
PEEPRPHAGSASVLRLRYPRLHSLGGLSSKSYCSTGPSGAGLPLAGSPDAVDGQAGCQEC
SPERGKEGTPGRENSTKMQINETIWDTVGAASRHGEGERQAKSSTRGCTHLAEGQGIYLQ
EEQSPPEMCTRVMEKGKDLQLRERCERWREGQLRKTRHALKAFLLSLMTETTKSGALEAA
LVDDHVMLPARNIEAPAMSTACHDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLG
KNKFRIIPQGLPGSIERDPLLPVWKALGIQAHKCVAHTTNPSKATAVHLPHLTMQPQGCL
MSFFPTAAEFSTYGQELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWIN
QENLESIDLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKL
ADDGMDRVSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIR