GENSCAN 1.0	Date run: 17-Jan-104	Time: 02:48:02

Sequence DIRAS2_1 : 4904 bp : 43.45% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1231   1830  600  0  0   90   49  1090 0.999 101.50
ccaaatttattggatttagaattgtcgctattttaaatgttatcacctcccatttttaag
ctatcaaaagagggtagagctatccttattaatgtttttatattttaattattaattctt
tcaaacatctggttcctttgctaggtgcgtcctggctgagagttggagctctccagcaac
ATGCCTGAGCAGAGTAACGATTACCGGGTGGCCGTGTTTGGGGCTGGCGGTGTTGGCAAG
AGCTCCCTGGTGTTGAGGTTTGTGAAAGGCACATTCCGGGAGAGCTACATCCCGACGGTG
GAAGACACCTACCGGCAAGTGATCAGCTGTGACAAGAGCATATGCACATTGCAGATCACC
GACACGACGGGGAGCCACCAGTTCCCGGCCATGCAGCGGCTGTCCATCTCCAAAGGGCAC
GCCTTCATCCTGGTGTACTCCATTACCAGCCGACAGTCCTTGGAGGAGCTCAAGCCCATC
TACGAACAAATCTGCGAGATCAAAGGGGACGTGGAGAGCATCCCCATCATGCTGGTGGGG
AACAAGTGTGATGAGAGCCCCAGCCGCGAGGTGCAGAGCAGCGAGGCGGAGGCCTTGGCC
CGCACATGGAAGTGTGCCTTCATGGAGACCTCAGCCAAGCTCAACCATAACGTGAAGGAG
CTTTTCCAGGAGCTGCTCAACCTGGAGAAGCGCAGGACCGTGAGTCTCCAGATCGACGGG
AAAAAGAGCAAGCAGCAGAAAAGGAAAGAGAAGCTCAAAGGCAAGTGCGTGATCATGTGA

aggcccttcctgcgggaggagcagctgtgtgtccccggcacctcactcccccaaaatgac
acccaccgtcgtcagggtagcatgtataatgcccacgtgttaaacattgcatttaatcga
gatgcgtcctattgtccttaagagggcgtttcacaccaccaacagtaagccacccactct

Predicted peptide sequence(s):


>DIRAS2_1|GENSCAN_predicted_peptide_1|199_aa
MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVG
NKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
KKSKQQKRKEKLKGKCVIM