GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:52:08

Sequence TSTA3_1 : 6506 bp : 64.91% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    396    453   58  2  1   65   94    52 0.541   3.10
ttcgtccggggacccgcccgcgcgcggccggcggacgagactgcgcttcccaagcggctt
tgcggccgcggactccaagtcccagctgtgcccgggacgctgcgcgcccccgggactcca
tttcccagagtgccccgccccagcctcccggccccgccccccacctggctccgcgggcag
CCGGAGCGCACCCGGCCGGAAGCCGCTGTCGGGGAGCCGGCGGTGGGGCTGGACGCAG
gtgaggtggcaccggactcagccgcgccctgggccctggatgctccgtgagagtcaggga
gcgctgtgggggtctgggatcgaggggcatgggggcagcctggggctgtggtagagggtc
tggctgcggtgaggtctccccgcgtgcttgggagccgcgcgacgcctgcgcagggccccc

 1.02 Intr +   1204   1360  157  2  1  104   94   148 0.995  17.26
agagctcccaggggaacagggctgcgacgagggagtgcctcggtccagctgggtctttct
ggttgccagtggactatgccccactctgagggcctcactctgtgccagttgccacagaag
agtggggctccaaaggatgagagcgtgatgacctcagcctcccactgtttgacattacag
GTGCAACTGACATGGGTGAACCCCAGGGATCCATGCGGATTCTAGTGACAGGGGGCTCTG
GGCTGGTAGGCAAAGCCATCCAGAAGGTGGTAGCAGATGGAGCTGGACTTCCTGGAGAGG
ACTGGGTGTTTGTCTCCTCTAAAGACGCCGATCTCAC
gtgagtgagcccatccccagatcagcccttcctctccatcctaccccccaccctagaact
aagagttccaggctgggcatgttgctgagtctaacagtagctgtgtttctgggtccttcc
tgccaggtggctggcctggcctgggtgtgcttggctgtgttcctggaaaaacaaacaccc

 1.03 Intr +   1707   1821  115  0  1   77  106    89 0.982  11.22
aaaaacaaacaccctcccatctcttcctggaagcctgcaccctcatatcagccaggccct
ggggccaccctcccttttgactgtccctcctgccatagtcccacccagttcctgcacttg
gcacccaaccctggggtgctggttccctccagagcctcctgacagcctggcttcctacag
GGATACAGCACAGACCCGCGCCCTGTTTGAGAAGGTCCAACCCACACACGTCATCCATCT
TGCTGCAATGGTGGGGGGCCTGTTCCGGAATATCAAATACAATTTGGACTTCTGG
gtaagtgagggtggccccagcaagcactggaaaccaggatcccaggttctgggaacttcc
tggcgggcttcccactctcacaggcccacattcccaccccaggaagtccctgaggatcag
ggcttggcacagcctggtgggggcagcccctgagggacccccagtcactcacacttggtg

 1.04 Intr +   3012   3140  129  2  0   83   77   201 0.998  20.57
gctggagagcaatggtgtctgtaagcccactgccttgtccggaaacggttaggatgggca
ggcttgggtcctcccagggctgaagggccagggtgtgtctccacttctgcgtctggagga
gcaggtaagggctgggatctggcctggggagcctgaactgtccccgcctcacccctgcag
AGGAAAAACGTGCACATGAACGACAACGTCCTGCACTCGGCCTTTGAGGTGGGCGCCCGC
AAGGTGGTGTCCTGCCTGTCCACCTGTATCTTCCCTGACAAGACGACCTACCCGATAGAT
GAGACCATG
gtgaggggcagggcctggctgtgggtggggccggggagccggtgggcagggccaggaagt
agcggcctctgcctctcccacgcccgcagatccacaatgggcctccccacaacagcaatt
ttgggtactcgtatgccaagaggatgatcgacgtgcagaacaggtcctcgcgcccatcct

 1.05 Intr +   3230   3303   74  1  2   72   28   119 0.999   3.65
ggcctttgaggtgggcgcccgcaaggtggtgtcctgcctgtccacctgtatcttccctga
caagacgacctacccgatagatgagaccatggtgaggggcagggcctggctgtgggtggg
gccggggagccggtgggcagggccaggaagtagcggcctctgcctctcccacgcccgcag
ATCCACAATGGGCCTCCCCACAACAGCAATTTTGGGTACTCGTATGCCAAGAGGATGATC
GACGTGCAGAACAG
gtcctcgcgcccatcctgctgaggcccagccaggagtcggggagagggcccccaggggcg
ggtggggccggctggtcgggtcttcgtgccagcctcagtaagaggccagcggcagcctgg
ggtgggatcgcgggcccaggacgagggcaggagacgctgtgcctccgcagggcctacttc

 1.06 Intr +   3474   3607  134  0  2   66   70   373 0.969  34.77
tgcagaacaggtcctcgcgcccatcctgctgaggcccagccaggagtcggggagagggcc
cccaggggcgggtggggccggctggtcgggtcttcgtgccagcctcagtaagaggccagc
ggcagcctggggtgggatcgcgggcccaggacgagggcaggagacgctgtgcctccgcag
GGCCTACTTCCAGCAGTACGGCTGCACCTTCACCGCTGTCATCCCCACCAACGTCTTCGG
GCCCCACGACAACTTCAACATCGAGGATGGCCACGTGCTGCCTGGCCTCATCCACAAGGT
GCACCTGGCCAAGA
gtgagtgcgtccgtccgatggggtgcccgggctcagctcgggaggaggtgacccagtgcc
tctgacacctgctccttccccaaatctgcaggcagcggctcggccctgacggtgtggggt
acagggaatccgcggaggcagttcatatactcgctggtgcgtaaaggaaggcacagctct

 1.07 Intr +   3699   3763   65  1  2  108   78    10 0.806   1.58
caccaacgtcttcgggccccacgacaacttcaacatcgaggatggccacgtgctgcctgg
cctcatccacaaggtgcacctggccaagagtgagtgcgtccgtccgatggggtgcccggg
ctcagctcgggaggaggtgacccagtgcctctgacacctgctccttccccaaatctgcag
GCAGCGGCTCGGCCCTGACGGTGTGGGGTACAGGGAATCCGCGGAGGCAGTTCATATACT
CGCTG
gtgcgtaaaggaaggcacagctctccccagagaacctgccctattgagccctgggctggc
ccctgctgggctgtcggggaggtggtgcaggagggaggctcctaccagcagagaatctgg
gctgagctccaagaggagccatctctggtcctcgtggaggccccataggctcctgtctcc

 1.08 Intr +   4110   4176   67  2  1   98   80   106 0.894  10.42
aggctcctgtctccaggagtcactggcgtagctctgagctccaagggagaaaggagggac
ccctgttccccaggctgagcccccactgaacaaggacagcagtatggactccccagcagg
ggcgtttgggagagggttggctatacccatggtctctgaccctgcctgtctgacctctag
GACCTGGCCCAGCTCTTTATCTGGGTCCTGCGGGAGTACAATGAAGTGGAGCCCATCATC
CTCTCCG
gtgggtacctcagccctcagcccccttcctccatggtaggacaggatccaaggttgtcct
gggaggctggctgaggggtgggagcaggaatattcatgggccgtcgggtggcaccaaggg
gaggcctgacccggtggctccccacagtgggcgaggaagatgaggtctccatcaaggagg

 1.09 Intr +   4324   4468  145  2  1   43    6   100 0.759  -2.17
agtacaatgaagtggagcccatcatcctctccggtgggtacctcagccctcagccccctt
cctccatggtaggacaggatccaaggttgtcctgggaggctggctgaggggtgggagcag
gaatattcatgggccgtcgggtggcaccaaggggaggcctgacccggtggctccccacag
TGGGCGAGGAAGATGAGGTCTCCATCAAGGAGGCAGCCGAGGCGGTGGTGGAGGCCATGG
ACTTCCATGGGGAAGTCACCGTATCCTCTGGCTCCAGTGCTGGGGGTTGGGCGGGGGCCC
CTTGGGCGGGCTCAGTGGCCACCCG
gtgtagggccagcgtgggtgggacactgcggagggaggatgctcaccctggcaggcggag
gagctctgctgtggctcccctgggaatggcagaggttcaagggcaagctgcgggggctgg
ggtggaggtgctcttctcgctgtggccttgacaaagcctccagtttgatacaaccaagtc

 1.10 Intr +   4625   4731  107  2  2   -1   84   183 0.838  10.02
ttgggcgggctcagtggccacccggtgtagggccagcgtgggtgggacactgcggaggga
ggatgctcaccctggcaggcggaggagctctgctgtggctcccctgggaatggcagaggt
tcaagggcaagctgcgggggctggggtggaggtgctcttctcgctgtggccttgacaaag
CCTCCAGTTTGATACAACCAAGTCGGATGGGCAGTTTAAGAAGACAGCCAGTAACAGCAA
GCTGAGGACCTACCTGCCCGACTTCCGGTTCACACCCTTCAAGCAGG
gtgagccctgaccccacagccctccacttggtggaggcctgccccagcccctccctcatg
ctcgctaccagggcagaggtgaggtgccccctcagagcctgtactgccctggaggtggga
caccaaagctctgaggggtgacttccctgtccctgggcctcctccccccacttcctccca

 1.11 Term +   4962   5017   56  1  2   93   48   116 0.916   6.72
ctccctcatgctcgctaccagggcagaggtgaggtgccccctcagagcctgtactgccct
ggaggtgggacaccaaagctctgaggggtgacttccctgtccctgggcctcctcccccca
cttcctcccatgcggccccgaccctccctgtccatggccctcacctgcctgcctctgcag
CGGTGAAGGAGACCTGTGCTTGGTTCACTGACAACTACGAGCAGGCCCGGAAGTGA
agctggaagacaggatcaggtgccagcggaccatcggctggcagagcccagcggccacca
cccgtcaaccctgccaggagctgagggcaccacccagcaacctgggcctgcattccatcc
gctctgcagccccaagcatctttccagtggggcccccattcacgttggtcctcagggaaa

Predicted peptide sequence(s):


>TSTA3_1|GENSCAN_predicted_peptide_1|368_aa
PERTRPEAAVGEPAVGLDAGATDMGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGED
WVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNV
LHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAY
FQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQF
IYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTVSSGSSA
GGWAGAPWAGSVATRLQFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFT
DNYEQARK