GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:45:25

Sequence TRIM35_1 : 28830 bp : 46.22% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1283   1717  435  1  0   84   94   712 0.993  67.57
gagcgccccctccctccccctcgccatcccccccgcacgattggccagcgccgctgtctc
tcagcgttccaggggaagggactgggcgattcccagcactcgggtcgcgggcgttggcag
ccgggcgggtgggaggggccggagcaaaagttccgggcgcccgagccggctgctcgtgcc
ATGGAGCGGAGTCCCGACGTGTCCCCCGGGCCTTCCCGCTCCTTCAAGGAGGAGTTGCTC
TGCGCCGTCTGCTACGACCCCTTCCGCGACGCAGTCACTCTGCGCTGCGGCCACAACTTC
TGCCGCGGGTGCGTGAGCCGCTGCTGGGAGGTGCAGGTGTCGCCCACCTGCCCAGTGTGC
AAAGACCGCGCGTCACCCGCCGACCTGCGCACCAACCACACCCTCAACAACCTGGTGGAG
AAGCTGCTGCGCGAGGAGGCCGAGGGCGCGCGCTGGACCAGCTACCGCTTCTCGCGTGTC
TGCCGCCTGCACCGCGGACAGCTCAGCCTCTTCTGCCTCGAGGACAAGGAGCTGCTGTGC
TGCTCCTGCCAGGCCGACCCCCGACACCAGGGGCACCGCGTGCAGCCGGTGAAGGACACT
GCCCACGACTTTCGG
gtaagagcagcgatttgcacgaggcggccgagccgggtctggaacccggaatcccttggc
tctgcggctcccgcccctcctgcctgccagagcccagtgtgcccgcgtctcgctcccagc
atgcaggaccccacctctccgacccaggttctcagggctggctgcttcttcaaggtcggc

 1.02 Intr +  13959  14054   96  2  0   81   99   185 0.085  19.11
gatcaggaccttacttaccatttgtgcccagagcacttggcatggatggggttaggcaaa
tgcagttgagttacacttgtgttgaagtggagtcccagttgtaaatgtgatgtgtctgcc
ctctctgcccagcctccagccctaacctgtcttcctccctctctctcattcccatgtcag
GCCAAGTGCAGGAACATGGAGCATGCACTGCGGGAGAAGGCCAAGGCCTTCTGGGCCATG
CGGCGCTCCTATGAGGCCATCGCCAAGCACAATCAG
gtgagcgaacgatggggccaagtgggaagattgggtccactcagggcagtctggggagga
gtgaagatgtgtcagccgtggctttggctcacataacccgctgggtagaggtcggctgcc
ttacctctgatggtcctgtgcagccacgtcctggatgctgactgtggcttctctgccttg

 1.03 Intr +  18208  18438  231  0  0  155   91   370 0.999  41.97
catttgaaatcggaacttagaaatttgtgcttataaactattatgttgatattttatctg
taggggttctatacatgatttatttgaacataaatttcctttgctaaaaatgggaaagtt
gctgggctatggatgtcctctccacatctgacccctgactcctcctgctgtcttccgtag
GTGGAGGCTGCATGGCTGGAAGGCCGGATCCGGCAGGAGTTTGATAAGCTTCGCGAGTTC
TTGAGAGTGGAGGAGCAGGCCATTCTGGATGCCATGGCCGAGGAGACAAGGCAGAAGCAA
CTTCTGGCCGACGAGAAGATGAAGCAGCTCACAGAGGAGACGGAGGTGCTGGCACATGAG
ATCGAGCGGCTGCAGATGGAGATGAAGGAGGACGACGTTTCTTTTCTCATG
gtaaggagctcagcgtctggattcagtgacagggccacatgttccaggaccagctgggag
ccatagcccaccagccctggccaacgtcatcttcctggagcttcctgggtactggcctgg
aggagctcacaagtaacctgctctgcttgtgtcatgaaactaaaaagacttatcagggcg

 1.04 Intr +  22340  22362   23  1  2  102  131    36 0.998   5.64
tgttcaacacatgaacttttggataatatgttcaaatcatagcagggatgttattgttaa
catcttgacaatattaagacttatgatccatggaatgcatgacttcttttgaggtcagaa
acatatacatttcctctacatctgtgtctctgtgttatttttttatttttattttttcag
AAACACAAGAGCCGAAAACGCCG
gtaagttgccaaagctggtggaggggaggggaagagtgggcagaaataccaggggtgcaa
actccagtggccccggggcaagcaggtaacaaccagctgggtgcaccagcacacatgagc
tactggccctggttttagagggagaggtggacaatggccaggtggagagagccctctcac

 1.05 Intr +  23238  23356  119  0  2  102   93   194 0.988  21.41
ccctgttggccttggcccatctcccatcgtagcccagtccagtcttgtcttggagaaggt
ggccaggaaacttgggcctgagggaagggaacaagtcctgttgctggtttccagttggcc
cagttcggcccaggttgcatggctctggccctgcccaccatacccattgtacttttccag
ACTCTTCTGCACCATGGAGCCAGAGCCAGTCCAGCCCGGCATGCTTATCGATGTCTGCAA
GTACCTGGGCTCCCTGCAGTACCGCGTCTGGAAGAAGATGCTTGCATCTGTGGAATCTG
gtgagcgggggtgccggcaggtgtcccaagcatgggtggaagcccttcatgttagcaaag
aggcaccagggctggtctctgccgggcccacctcccacctcctcagagctcccctcctct
ctcagctgatccctctgccagtccctcgcaggcaggttcctgtaccctggtcttttccac

 1.06 Term +  24391  24968  578  2  2   79   49   794 0.998  69.23
tgccgcatatcttctgggggatacagcccaacccctgccaccactccagccctgggccac
tccttgcatggacttggggccaggtgtgacacagtggttggtttgtggggctggagatat
ccacgtgtggcctaagggacctcaggtttgctgattccccatttccgcctctgcttgcag
TACCCTTCAGCTTTGACCCCAACACCGCAGCTGGCTGGCTCTCCGTGTCTGACGACCTCA
CCAGCGTCACCAACCATGGCTACCGCGTGCAGGTGGAGAACCCGGAACGCTTCTCCTCGG
CGCCCTGCCTGCTGGGCTCCCGTGTCTTCTCACAGGGCTCGCACGCCTGGGAGGTGGCCC
TTGGGGGGCTGCAGAGCTGGAGGGTGGGCGTGGTACGTGTGCGCCAGGACTCGGGCGCTG
AGGGCCACTCACACAGCTGCTACCACGACACACGCTCGGGCTTCTGGTATGTCTGCCGCA
CGCAGGGCGTGGAGGGGGACCACTGCGTGACCTCGGACCCAGCCACGTCGCCCCTGGTCC
TGGCCATCCCACGCCGCCTGCGTGTGGAGCTGGAGTGTGAGGAGGGCGAGCTGTCTTTCT
ATGACGCGGAGCGCCACTGCCACCTGTACACCTTCCACGCCCGCTTTGGGGAGGTTCGCC
CCTACTTCTACCTGGGGGGTGCACGGGGCGCCGGGCCTCCAGAGCCTTTGCGCATCTGCC
CCTTGCACATCAGTGTCAAGGAAGAACTGGATGGCTGA
gctggcccggggctgccccggtcttgtgccacagcactgttttctttctgccctcttcct
aatgcccacactgcttgggcactattgcgcccctgcctccttgccaggctcttcctcctg
tcctgcctggtccttttccatgactccaggctgtgcctctctccatgtttggtcccttct

Predicted peptide sequence(s):


>TRIM35_1|GENSCAN_predicted_peptide_1|493_aa
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVC
KDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLC
CSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEA
AWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIER
LQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVE
SVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEV
ALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPL
VLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRI
CPLHISVKEELDG