GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:51:05

Sequence TOP1MT_1 : 27924 bp : 57.29% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1220   1341  122  1  2   33  110   204 0.992  14.88
cggcaggacagtcagtggtcctgctgccgcagccccgtgcaggcttagaccgcccagcct
tgggatgagcgccgctgggggcggaggccgcgctcgggggcggggctggccgctgggggc
ggggcggggctggccgctggggcggggcccagcttgtcgctctttcccggaggctggcag
ATGCGCGTGGTGCGGCTGCTGCGGCTCCGGGCGGCTCTGACGCTGCTCGGGGAGGTCCCC
CGCCGCCCGGCCTCCCGGGGTGTCCCGGGCTCGCGCAGGACGCAGAAGGGCAGTGGAGCC
AG
gtaaggtgtcccagtgagcaggcggcgagggccctgagcaccgggcttgggtaggtccag
aaaggggagtggcaggcctcgtgggacggccttgccctgcttccggttttcccaaaagtc
gggccaggagagcatgcgtgccgcggtgtgaccggcccgcctcctgcccggggtgtacag

 1.02 Intr +   1746   1863  118  0  1   56   47    69 0.859   1.24
caaccctatttggggaaatctcccctctttttttccgcttgtggtttcatcatttgtgta
gctgtgcctgggcctcaacactgtagggtttggttaggtactttataaaaagcttatgtt
gctgtgcatggtcttctgagacccgctctttcctggagtcggttcccgggttgtctccag
GACCGATTCTGCATGGCGGCGGGCGCTCACTGTCATATCTACATCACCAGGCACAAGCCG
CATGGATCCAGTGGCCCTGGTGGCCGTTGGTGGTCCCAGGCGCTTTCCTGGAGGACAT
gtgagaagccctgccggcgcatactgggcctggggtagccgcatggggatgggtctctgc
gcatgaaatgctggagtttccgaagagctggagagttgacagcctcactggtgcgtggga
gatcctgcaggagttcccgccaggtctcgcggtttatcatcattcacttagtgcttccag

 1.03 Intr +   2154   2285  132  2  0   75   96   -14 0.426   0.12
gtgcgtgggagatcctgcaggagttcccgccaggtctcgcggtttatcatcattcactta
gtgcttccagcgtggcatgtctctgtgacctggtggtgcgctatcagcatacccattcac
agctgagggcctgcacagctgcctaaggccatgctgcagaaatgtcctgtctgcctgcag
GAGCTTGGGACCCAAAGAGAGCCCCAGATGGGGCAGGGTGTCTTGGGAGGAGGGAGTTCT
GGCCTGCGCTTGGAGCTGGGGCTGGCTGTGGGCCCTGCATTGAGGCACATCTCTCCGAGG
GTGCACAGGCAG
gtaggtgctttccaaaaagtgctgctgagctgcagtcgcccaggtggacaggtgggtttg
gagcaaggtctctggctttgaaagccagcttgtgtctgatggtggtgcttggtgccctgg
tctctgcaggggtgaaagaatgtcactacaatgtgcagccctcagttgggcttgagcgca

 1.04 Intr +   3480   3594  115  2  1   89   75    38 0.815   3.79
ggatcacaggcgtgagccaccacgcccggctccaccctggaaggttcttgagcccgttaa
cttctccctactttatcagctccgtctctacgtcttctaaccttgcccattccctcctct
gcagaaacagccagaaaggccctttcagaaatgtctgttgcacatgctttcccctctcag
ACCCTTCAGAGACTTCCTGTTGCTCTGAGGACACTCATCCCAGCCGACCAGGCCCACCAG
GCCCCCAACAGCACTACCTGGCTGGGGTCACGTGCAGGTCTCCTGGCTCTGGCAG
gtgggggtgtgatctggaaccttctgtccttgtgcgtctgggggaggctcagaaggtgtg
cccatctcactctcccccatcctgatggtgctcccaccctctcgccaaagcctctcccac
tgaggcctttgcactggccatcctgggtgctggacttgctcttcccgcagccctgctgac

 1.05 Intr +   4489   4579   91  2  1   63   91    56 0.964   3.61
cggaggcagggctctctcataagcagccaggtcctttatttagcaaatgaaatggtccca
tggagaggttcccgaagattctagaccggctctgaagggacccatctggggagaggccct
agagcctgggagaggcacgttgcctttcccacttagctgggcttgccctttcccgcttag
CTGGGCTTGGTGGGATCCGTGACTCAGCAGCACACGGGCCTCTGCAGGTGGGGGGCATGG
GCGGGTACACGGGCATGGGGTCTGAGGTCAG
gtagggttgcctccctctgcaggccttgttttcctcccccgtgaggtggaggccacactg
ctcacctgctaggagccacagggaggagccactgtgggagcggggaagaggctcatgcag
ggcctggcccaggagagtgacacgtcctgtctccgtctttaggtgggagaaggagaagca

 1.06 Intr +   4742   4857  116  2  2  120  116   134 0.999  20.66
catggggtctgaggtcaggtagggttgcctccctctgcaggccttgttttcctcccccgt
gaggtggaggccacactgctcacctgctaggagccacagggaggagccactgtgggagcg
gggaagaggctcatgcagggcctggcccaggagagtgacacgtcctgtctccgtctttag
GTGGGAGAAGGAGAAGCACGAAGACGGGGTGAAGTGGAGACAGCTGGAGCACAAGGGCCC
GTACTTCGCACCCCCATACGAGCCCCTTCCCGACGGAGTGCGTTTCTTCTATGAAG
gtaaggatgcagggagcggctcctccccagcctgcgcttggttccctgggcgtgggctcc
cagtgggcatctggctcgctccctcagcccccctgcaggcttctggctatgagcgctctg
tgccctcttcttgcaggtgatgcgtgggggctgctgaccaactgacccatgctcagaggg

 1.07 Intr +   6610   6731  122  2  2   92  100    89 0.115  11.89
ccacgcaggttgattgtcgtgtgtcatgcagaacatgcttctgaacttacagaagaaggc
ctagcttcttgctcttggcatagtacgcacgaaagcgtagtttaaagcaatgaggtcatg
tcagctggaggccgagcctctggccgctctctcatacgatgtgtcttccgatgcctgcag
GAAGGCCTGTGAGATTGAGCGTGGCAGCGGAGGAGGTCGCCACTTTTTATGGGAGGATGT
TAGATCATGAATACACAACAAAGGAGGTTTTCCGGAAGAACTTCTTCAATGACTGGCGAA
AG
gtaggtaccctgggcggccgccacagctgtcctggacctggctggctaggcgtctgcggt
tctgcagtgctgcctctgaacgcccctcgcaagttctcggtggcccctgtgtgaccactc
acaggtgccgtcatggctctttgcagcttcgagctcctgggctcaagccatcctcctgtc

 1.08 Intr +   9737   9859  123  1  0   65   47   231 0.683  18.66
ggggtctgcggggagaggctctatttacggggccgcaggaccgtgcgcaggttctgccta
ttgcacacacgcctccgtcggacatggcgagagcgcgtttctgtccgtcagacatggcga
gagcgctctgcatgtctgtccttcagacatggtgagagcgcgtgtctgtggtttttgcag
GAAATGGCGGTGGAAGAGAGGGAAGTCATCAAGAGCCTGGACAAGTGTGACTTCACGGAG
ATCCACAGATACTTTGTGGACAAGGCCGCAGCCCGGAAAGTCCTGAGCAGGGAGGAGAAG
CAG
gttgggctgcctcgagcgttgtgtgacctgaagtggcccctgggaacgagaggccggcct
ggcccaaagactgagaaaggcctgtggccttagagaagccccttctcacaaagctgctct
tttctcgtcagccttagcgcccctgcatgtgcttaagtgtcgttccgcttccccagagca

 1.09 Intr +  10548  10735  188  2  2   56   96   142 0.991  11.49
ccccctgcaagcccacctgcactgtcccctgcccctgcaacctccatggattgtgaaggg
ctttgagggtccagctgagttagccagacagagcagggtggtcccgggttagcaacaacg
gactgaggcctgttctcttctcttcactgctaatgtccactgactgttttattaactcag
AAGCTAAAAGAAGAGGCAGAAAAACTTCAGCAAGAGTTCGGCTACTGTATTTTAGATGGT
CACCAAGAAAAAATAGGCAACTTCAAGATTGAGCCGCCTGGCTTGTTCCGTGGCCGTGGC
GACCATCCCAAGATGGGGATGCTGAAGAGAAGGATCACGCCAGAGGATGTGGTTATCAAC
TGCAGCAG
gtgcgtggccgggcgggcagcaggcgggcactggacccccgccacccgggtgaggctggc
ttttcttcacctcctgggagagggaggcacaccgagaaacatgtggttggtgacccccac
accattcctgtggagctcagcctgtaggcgtggccgggcaagggcggccttcccagggtg

 1.10 Intr +  11452  11596  145  1  1   65  105   256 0.998  26.47
tagattgagtggctgcttttgtctgagctgccaggcaggccacctctgatgccagactcg
gtcaggagccatgccaccaccatagccaccacgtgggacggttgaccagagcagctcctt
ttgcttgcattccagagaataaggtctccaagttatgtttgggtcgttgttctgctgcag
GGACTCGAAGATCCCCGAGCCGCCGGCGGGGCACCAGTGGAAGGAGGTGCGCTCCGATAA
CACCGTCACGTGGCTGGCAGCTTGGACCGAGAGCGTTCAGAACTCCATCAAGTACATCAT
GCTGAACCCTTGCTCGAAGCTGAAG
gtgagcgcagggcttggcagggtgtttcctccccaggaggtccccctgaggacgccggca
gggaggtgtgtaagccgggcaccggcagaggcttctgagatgggctgggagtcggccagc
ccgtgctgaggtcatgctgtgccagcaggcacaagccccaaagccaggagtgggcatggg

 1.11 Intr +  11939  12082  144  1  0   89   91   241 0.971  26.16
gccaggagtgggcatgggtgctcactgccggcatcacccagctagatttgctgccccagc
ccctgaccacggcaccactgagtggagaagcacgaggtttgggggagggagagttgacag
cctcctccgttatttaacaggaatgtgaatgttttctttcctgttattttcttcgtttag
GGGGAGACAGCTTGGCAGAAGTTTGAAACAGCTCGACGCCTGCGGGGATTTGTGGACGAG
ATCCGCTCCCAGTACCGGGCTGACTGGAAGTCTCGGGAAATGAAGACGAGACAGCGGGCG
GTGGCCCTGTATTTCATCGATAAG
gtatgcggccttctcgcttcctggcggctcttcatcctggttctcctggcgaggactccc
agttggatggtgcagtgtggcgacgtgggcctgtgtgtggggtggaacctcattctgatg
gggggggtgtgtgcatgtgcacacgtgtgtgggtgtgaacatgtgtgtagggtgtgcatg

 1.12 Intr +  14695  14880  186  0  0   27  117   355 0.995  33.39
gtgtgtgtggcgtgcgtgtgtggcgtgcgtgtgtgtggcgtgcgtgtgtggagtgcgtgt
gtgtggcgtgcgtgtgtggcgtgcgtgtggcgtgcgtgtgtggcgtgcgtgtgtgtggcg
tgcgtgtgtgtggcgtgcgtgtgcacgcaccacccactttgaccattccccaccaactag
CTGGCACTGAGAGCAGGAAATGAGAAGGAGGACGGTGAGGCGGCCGACACCGTGGGCTGC
TGTTCCCTCCGCGTGGAGCACGTCCAGCTGCACCCGGAGGCCGATGGCTGCCAACACGTG
GTGGAATTTGACTTCCTGGGGAAGGACTGCATCCGCTACTACAACAGAGTGCCGGTGGAG
AAGCCG
gtgagtgccctcgcgccagctgcccccgctatgtgacacgtatttgctctggatgtctgg
gggcgtgccggagctgccgtggggtctgtggcccgtttgccacgtcctgcctgctgggtg
aggcctgctgtgccggggctgatcggggtaaaggtgaaggagaggctgtgcaccatggta

 1.13 Intr +  17995  18063   69  0  0  144   77   107 0.980  15.73
gccacactggagggtgggggccgtgtcacgggaggatgccgacaggtgacggtgatgctg
ctcgggccaccttcctcagggaagcctcccgtgggctcccaggctctgcgtagacgccct
tcaggtcctcactggattcgggttttttctgtcctctgaaattccttctttctccttcag
GTGTACAAGAACTTACAGCTCTTTATGGAGAACAAGGACCCCCGGGACGACCTCTTCGAC
AGGCTGACC
gtaagccggctcgtgtttcctcagcagtgggcggcggcaggacccagtgagagggcgtgg
gcgctgagtctggcccagggttttgtcctgacccaacggctgacatgtcctttccttccc
gcgggaggctgggacggccccgcaaaaccacgtaattatagagaccattttcctccccag

 1.14 Intr +  18244  18358  115  0  1   66   89   273 0.971  26.39
gtaagccggctcgtgtttcctcagcagtgggcggcggcaggacccagtgagagggcgtgg
gcgctgagtctggcccagggttttgtcctgacccaacggctgacatgtcctttccttccc
gcgggaggctgggacggccccgcaaaaccacgtaattatagagaccattttcctccccag
ACGACCAGCCTGAACAAGCACCTCCAGGAGCTGATGGACGGGCTGACGGCCAAGGTGTTC
CGGACCTACAACGCCTCCATCACTCTGCAGGAGCAGCTGCGGGCCCTGACGCGCG
gtgagcctgccccacacccacactcagcgcggggggagcacggcccctgccccagaccgg
gctccccggctggcccttgttgagtgagcctcggggtggggccgcttctttgggaaatgg
gctgaggttgtgggctggctgcttggcagcctaggtggccagagtcctggggaggaggag

 1.15 Intr +  18973  19198  226  2  1   37   68   136 0.533   4.77
gtcccctgccatcaacctggggatgctgtctaagcttggcgagggcctctcctccctctg
tccctggcgctgcccctgctccgtgatgtccgggctgctctgtgatgtccgggcagattg
gacgcacagactgtccagagggtgcctcccaccccggcgcccaccgcactccccaagcag
GGCTTCCTGGAGGAGGCGCCGAGGCTGGGTGCTCAGGGGCGCTGACGCTCGGCATGTGTT
TCGCGTGCACCCGTGGGCCTCAGAGGCCGGTGCTGTGCTGCCCTGGGGACAACCTTGGAG
CTGGGGCAGCACTGGGGCTGTGGGATGCGGAGGAGCTAGCTGGCATCCAGGTGAGAGCCC
CAGGAGAGGAGACGCCCCCTCCACTGAGGGAGGCAGAAGATTCTGG
gtgagggcataggggccgaggccgggcctgggagaggaaatgaaggtgctgggcccactg
tggacgtgcttccagagctgggtgggccatgcaggatgggcgtgaaggagtggccgctcc
agtaggtgccttggggccagtgcttacgttctctgaacctcattcttgactggaaaatgg

 1.16 Intr +  19941  20082  142  0  1   34   64   179 0.672  11.64
gttaaagacgctgggccctgctctcgaggccaccttggagggtcactgacccttggccct
cactctccccatcccagtgggtgcctgtgtgagtggaaggggctgcgctgtgtggcgcgt
taaggccggctcagggcagacagggagggtggccggccccgtgggtgctgcctctgacag
CCCGTGCCTCTCAGCCGAGGACAGCATAGCAGCTAAGATCTTATCCTACAACCGAGCCAA
CCGAGTCGTGGCCATTCTCTGCAACCATCAGCGAGCAACCCCCAGTACGTTCGAGAAGTC
GATGCAGAATCTCCAGACGAAG
gtagcagctcccaggagagcccccagcccagccctcaagggacccctccccctccccaga
gcctcggcacaggcctgggagccagctgcggtgggcacgtagggtgtggaagggtgtggg
cacaggggctggtgcgggatggggaggggcagccctgtctggacccttttcctgcagatc

 1.17 Intr +  20260  20354   95  0  2   76  105    28 0.948   3.22
aaggtagcagctcccaggagagcccccagcccagccctcaagggacccctccccctcccc
agagcctcggcacaggcctgggagccagctgcggtgggcacgtagggtgtggaagggtgt
gggcacaggggctggtgcgggatggggaggggcagccctgtctggacccttttcctgcag
ATCCAGGCAAAGAAGGAGCAGGTGGCTGAGGCCAGGGCAGAGCTGAGGAGGGCGAGGGCT
GAGCACAAAGCCCAAGGGGATGGCAAGTCCAGGAG
gtgagtacccgtgccctcagacgccttctcccggggccctgtcccaacccgtagggtcca
gccccacagggtcggtgggagacgacccttgttgtctccttgtgcggagacgagagattg
tagaaataaagacacaagacaaagagataaaagaaaggacagctgggcccgggggaccac

 1.18 Intr +  25864  26013  150  1  0   65   78   349 0.989  32.07
ggggtggggctgagcttccacctttgatcccggctggtcttttgctgtgatggatgactg
atgacaatgacagggacagggctgcactgggagggaaggcggcagggccagagaagtgca
ggtctcctcaggtggcgctagtccagcgcggggcctcgcggcctcctcttctcttgccag
TGTCCTGGAGAAGAAGAGGCGGCTCCTGGAGAAGCTGCAGGAGCAGCTGGCGCAGCTGAG
TGTGCAGGCCACGGACAAGGAGGAGAACAAGCAGGTGGCCCTGGGCACGTCCAAGCTCAA
CTACCTGGACCCCAGGATCAGCATTGCCTG
gtgcgtgtgcctggggtctcagttcccacctgtggcctatggggggcctgggttttccag
gaggcctctgttcagtcccagcattgcccttgtcccgtgtcccctggggtcagcacaggc
cctccctgtgacagggacccatgatgctgagtcctgtgtcatcagctctccctgccctga

 1.19 Term +  26538  26640  103  0  1  100   43   131 0.984   8.48
gatgctccagggtggcggcatgcgtggggtggggttggcctagaggagcaggtcccagct
acaccaggcggctctggtgtctctgctgcatggaggacgctcgcccttgccgagcaccct
gacctggccttcaaggtgggtgagttgcctgcttgcctgggctgatgctgcctcccgcag
GTGCAAGCGGTTCAGGGTGCCAGTGGAGAAGATCTACAGCAAAACACAGCGGGAGAGGTT
CGCCTGGGCTCTCGCCATGGCAGGAGAAGACTTTGAATTCTAA
cgacgagccgtgttgaaacttcttttgtatgtgtgtgtgtttttttcactattaaagcag
tactggggaattttgtacaataaaatgtgtgcaagtgcttgtacatcactagaaaaagtc
cccaggccggccgggcacggtggctcacacctgtaatcccagcactttgggaggctgagg

Predicted peptide sequence(s):


>TOP1MT_1|GENSCAN_predicted_peptide_1|833_aa
MRVVRLLRLRAALTLLGEVPRRPASRGVPGSRRTQKGSGARTDSAWRRALTVISTSPGTS
RMDPVALVAVGGPRRFPGGHELGTQREPQMGQGVLGGGSSGLRLELGLAVGPALRHISPR
VHRQTLQRLPVALRTLIPADQAHQAPNSTTWLGSRAGLLALAAGLGGIRDSAAHGPLQVG
GMGGYTGMGSEVRWEKEKHEDGVKWRQLEHKGPYFAPPYEPLPDGVRFFYEGRPVRLSVA
AEEVATFYGRMLDHEYTTKEVFRKNFFNDWRKEMAVEEREVIKSLDKCDFTEIHRYFVDK
AAARKVLSREEKQKLKEEAEKLQQEFGYCILDGHQEKIGNFKIEPPGLFRGRGDHPKMGM
LKRRITPEDVVINCSRDSKIPEPPAGHQWKEVRSDNTVTWLAAWTESVQNSIKYIMLNPC
SKLKGETAWQKFETARRLRGFVDEIRSQYRADWKSREMKTRQRAVALYFIDKLALRAGNE
KEDGEAADTVGCCSLRVEHVQLHPEADGCQHVVEFDFLGKDCIRYYNRVPVEKPVYKNLQ
LFMENKDPRDDLFDRLTTTSLNKHLQELMDGLTAKVFRTYNASITLQEQLRALTRGLPGG
GAEAGCSGALTLGMCFACTRGPQRPVLCCPGDNLGAGAALGLWDAEELAGIQVRAPGEET
PPPLREAEDSGPCLSAEDSIAAKILSYNRANRVVAILCNHQRATPSTFEKSMQNLQTKIQ
AKKEQVAEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQEQLAQLSVQATDKEENK
QVALGTSKLNYLDPRISIAWCKRFRVPVEKIYSKTQRERFAWALAMAGEDFEF