GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:40:36

Sequence TNFRSF10D_1 : 29030 bp : 45.80% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1283   1432  150  1  0   24  117   144 0.494   9.31
gtgcctggaagtgactgcgggaagggagtacaactgaccacgccttttttccggggtata
aaagcggaggagcacgttctattctggcagtgtagctgcgagaacctttgcacgcgcaca
aactacggggacgatttctgattgatttttggcgctttcgatccaccctcctcccttctc
ATGGGACTTTGGGGACAAAGCGTCCCGACCGCCTCGAGCGCTCGAGCAGGGCGCTATCCA
GGAGCCAGGACAGCGTCGGGAACCAGACCATGGCTCCTGGACCCCAAGATCCTTAAGTTC
GTCGTCTTCATCGTCGCGGTTCTGCTGCCG
gtgagtctccgccgcggtccctggctggggaagagcgcacctggcgccgggagtgggcag
ggagagagggggacacggtggggatgcttggcccgggtcgcctgcggccgggcatgtctg
ggcaggacgaacccgccgtcggagtcaggggaagagtggggtgcccgggctgggcaggag

 1.02 Intr +  10239  10344  106  2  1  127   55    98 0.938  10.19
aaaatagctacctaacaggccaggggacaaacacggatgcaaaagaatgaaagtttggaa
tgggaaaaaagtccaggctctcatgggttttgtcacttggggtgaagggaatgtgagacg
gagcctgggagaggtaaggtctggaagccactcaagcccatctctgccttgtccccacag
GTCCGGGTTGACTCTGCCACCATCCCCCGGCAGGACGAAGTTCCCCAGCAGACAGTGGCC
CCACAGCAACAGAGGCGCAGCCTCAAGGAGGAGGAGTGTCCAGCAG
gtgcactcttatttttaaaaatcagtttatttttagttgacagataaacattgtatatat
tcatggtgtacaccatgatgtttggaaatatgcacgcattgtgaaatggctaaatcaagc
taattcacatacttatcgtgtatttgttgtaagaacacttaaaagtctactcagcaattt

 1.03 Intr +  16667  16780  114  0  0  135   92   -18 0.772   3.72
agtgccagtcaaaggtatgtaatagtgtaatagatgcagaattgatgacaagaccaagcc
aagaagagcagatttctctgtctggattccactgagggccaaaagagaaatttgccagcc
attgtcagcctctgggaattctgtggtgactcattcattaacttttctctcccttcccag
GATCTCATAGATCAGAATATACTGGAGCCTGTAACCCGTGCACAGAGGGTGTGGATTACA
CCATTGCTTCCAACAATTTGCCTTCTTGCCTGCTATGTACAGTTTGTAAATCAG
gtacagaatgtgtggaccccttgcccagaggtggagtgcatagtgatgaggtgggagctg
tagccgatgtgagtcggggaaccaagttctagcccaacttggtagtcttcatcatgccct
gttccatgattatgactagttgattaaaaaaaaaaaatagaaatcttttttttcttttct

 1.04 Intr +  18146  18257  112  0  1   60   90    93 0.995   6.14
ttggtccttacatacagggtgggtgtcctgtatgagtcccgagtgtgctggtgcagaaac
cagccctcagaactccttggtgaactgagttgagctgagtgggaggggatggggtggtga
ggaagggtggacagacatgtcagggaaacacattctcaaaaccttatgctctgttgtcag
GTCAAACAAATAAAAGTTCCTGTACCACGACCAGAGACACCGTGTGTCAGTGTGAAAAAG
GAAGCTTCCAGGATAAAAACTCCCCTGAGATGTGCCGGACGTGTAGAACAGG
gtaagacagcagccaggggctcccaacagctttcaggaacctgaaaagacctgattcacc
tggtacctctatctctccgctgaccccatggatcctccaggcccgaggcctccctgagcc
tgtggggtttcctgagcctgcgttggcccctcctggtccatctgcctgtccccaccccta

 1.05 Intr +  19297  19550  254  1  2   88   96   130 0.983  10.88
gcatgctcagacccttccccagcctcaagaagggagcacagggggacccactgctgacac
gaggagcctgtcctcctgacgccttctcagggactttgggcagggagggtggctcctctt
tcatcccacctggccagctttccatcaagagtccctgtctccctctctgtgtgtacccag
GTGTCCCAGAGGGATGGTCAAGGTCAGTAATTGTACGCCCCGGAGTGACATCAAGTGCAA
AAATGAATCAGCTGCCAGTTCCACTGGGAAAACCCCAGCAGCGGAGGAGACAGTGACCAC
CATCCTGGGGATGCTTGCCTCTCCCTATCACTACCTTATCATCATAGTGGTTTTAGTCAT
CATTTTAGCTGTGGTTGTGGTTGGCTTTTCATGTCGGAAGAAATTCATTTCTTACCTCAA
AGGCATCTGCTCAG
gtaggtgctggctgagggtgggagcgctgggcactgtctgccctgccctctcccactccg
ttcccacagacagtaatccccatccctgcccctggtccaagcgtctccagcctggcttgg
tcttccttcttgtgatcgccccatccccacgtcctgtgtatccccaaggaccctggtctc

 1.06 Intr +  20129  20160   32  0  2  112   70    14 0.937  -0.15
ccccttctcatcccccttcctcagggtgtcccctaattgcaaggccccattctgtcccca
gccccagggctccttgtccagtgtcccagcccccagccagccctgcgccccactgtcctc
tgggagggaggtgctgcatgggcccctccccgcctgctcaggagactgcttcttttccag
GTGGTGGAGGAGGTCCCGAACGTGTGCACAGA
gtgagttggtttctccagaaactgggggcttcgtgggttcaggaactgcttcccatccac
tgccgagcctgggtgggcacaatcccttgtcctcatggctgccctgactctctgacatgg
cctgggggatctgggctgactgtgggggacacacggccattttgagcagcacacagacca

 1.07 Intr +  20583  20768  186  2  0   81  105   156 0.993  16.49
ccccatggggatggggtgaccacctgacccacctcagcatggggtcctggatgtgctgag
cctcagctgcctggggtgacctcattggaaggggttggggatggcaggtccagctgtgta
ctggggaccctgaagctgagcccggggtgtggacttgagtgggctctttgtcttcccaag
GTCCTTTTCCGGCGGCGTTCATGTCCTTCACGAGTTCCTGGGGCGGAGGACAATGCCCGC
AACGAGACCCTGAGTAACAGATACTTGCAGCCCACCCAGGTCTCTGAGCAGGAAATCCAA
GGTCAGGAGCTGGCAGAGCTAACAGGTGTGACTGTAGAGTTGCCAGAGGAGCCACAGCGT
CTGCTG
gtgagttgaggagggactgtgccctgcctggcgtgcagcctgcacaggactttgtagaca
gtgggacatggcagtgcctcctctttcctggcccaaggggacatggagcctttgggagac
aggggactgcaggggacggagcagctgcactgaggtggtgaccgtgccagtctgcaggac

 1.08 Intr +  26958  27030   73  2  1   93   98    32 0.996   3.68
tctcaatgagccaccagcacacagagcccaagagctatggaggaccagaggtttgtctcc
atctccatggagacccaagagggaaagcgctgcaggtctcttgctggctagtggtcaggg
tcagtactagactgcaggactcctgactctgaccagagcattccccactgtgtgttacag
GAACAGGCAGAAGCTGAAGGGTGTCAGAGGAGGAGGCTGCTGGTTCCAGTGAATGACGCT
GACTCCGCTGACA
gtaagtgttttgtgccttgagacgcagcaggaggacagggaatagggacggtgtcctaac
tgctgtccctatagctgagagggctcttctggaggtttcactgctggaagcagggggccc
catgtcgatcctgtgctgatcgtccttggagcattgagaccctaaatctcttctctcttc

 1.09 Term +  27215  27348  134  0  2   86   48   147 0.999   8.75
gtgttttgtgccttgagacgcagcaggaggacagggaatagggacggtgtcctaactgct
gtccctatagctgagagggctcttctggaggtttcactgctggaagcagggggccccatg
tcgatcctgtgctgatcgtccttggagcattgagaccctaaatctcttctctcttctcag
TCAGCACCTTGCTGGATGCCTCGGCAACACTGGAAGAAGGACATGCAAAGGAAACAATTC
AGGACCAACTGGTGGGCTCCGAAAAGCTCTTTTATGAAGAAGATGAGGCAGGCTCTGCTA
CGTCCTGCCTGTGA
aagaatctcttcaggaaaccagagcttccctcatttaccttttctcctacaaagggaagc
agcctggaagaaacagtccagtacttgacccatgccccaacaaactctactatccaatat
ggggcagcttaccaatggtcctagaactttgttaacgcacttggagtaatttttatgaaa

Predicted peptide sequence(s):


>TNFRSF10D_1|GENSCAN_predicted_peptide_1|386_aa
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL