GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:40:07

Sequence TNFRSF10B_1 : 51441 bp : 43.88% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1438   1629  192  2  0   53   97    92 0.064   6.06
gaatttgcagttgcacattggatctgattcgccccgccccgaatgacgcctgcccggagg
cagtgaaagtacagccgcgccgccccaagtcagcctggacacataaatcagcacgcggcc
ggagaaccccgcaatctctgcgcccacaaaatacaccgacgatgcccgatctactttaag
GGCTGAAACCCACGGGCCTGAGAGACTATAAGAGCGTTCCCTACCGCCATGGAACAACGG
GGACAGAACGCCCCGGCCGCTTCGGGGGCCCGGAAAAGGCACGGCCCAGGACCCAGGGAG
GCGCGGGGAGCCAGGCCTGGGCCCCGGGTCCCCAAGACCCTTGTGCTCGTTGTCGCCGCG
GTCCTGCTGTTG
gtgagtccccgccgcggtccctggctggggaagagcgtgcctggcgcctggagagggcag
ggagagagggggacacggcgggggtgcgtggcccgggtcgcctgcggccgggcatgtccg
ggcaagacgcaccagtcgtcggagtcgggggaagagatgggtccccgggttgggcaggag

 1.02 Intr +  20333  20541  209  0  2   80   68    82 0.062   4.20
acgcaaaacctgatatcaaccaaagggaaagtgggtgtatgagccagccctgttgcttcc
cttggcagtaccggataaatggcttaaccagcccaaatgggaaaacaataggctcctggc
ctaagatcccattgactcaccctttgagcacgtccgctccttatctctgttcttccccag
TAGAGAAAGGGACGTGTAGATTTGCACATAAACAGCCCTCTGGAGGGTCCCCTGGGGAAA
CCTCACCTGACAGCTGCTGGGATCCTCCTGAAGACTGTCTCATCGCAAGCTACCAGCCGC
TGAACGCGGCACTGTCCTTATCTTCTGGCTGGCGACTTTTTTGTTCCCAGACCAAACTGA
GGGTGGGGCTGCCCAATAATGAGATGCAG
gtgaatctcgctgcccaataagaagatgcaggtgaatctcgctgcccaataatgagatgc
aggtgaatctcactgcccaataatgagatgcaggtgaactggggaggaagagagttttta
tttctgtaactggttacaaggagaaggcctggaaattatcaccagaccaactcaaaatta

 1.03 Intr +  32527  32632  106  0  1   85   79    85 0.954   7.09
aggaacccaaagtggccaagtggcagtcttcaagttacacagaatcactgttgtgtctcc
tcatggaatcattcctccctctgaaactcagagctctagcaaagcataaagcagcaaaaa
ttttgataacaggccactaagggtaatgtggagtggggccattcctgcttccacccctag
ATTCCTGGACACATGAATCCTAGCAATGGAAGAAGCAACCGCATGTATTGGAGGATAATT
CAGAGCATAGACAGTCTCCTGGAGAACCTTGTTGCAGCCCTTCAAG
gtactgccacccagctgacattgtaaatgagttttcaaaaagccatatcccaccatctta
ccaagccagcagttttgagatggtggggaacatggtaagaccagtaattccatgagcaca
ggcccattatagtgggcgcttcatttgccatcaagtgagtccctcaatcagaagcaatgc

 1.04 Intr +  39508  39621  114  2  0  115   92   -10 0.662   2.52
cttttggcagtgctggtttaaggtgtgtaaatgcagaattgatgaactgaccaagctagg
tagaggagatttccctcttttggttccacacatccctgaaagaggagtcccccagccacc
actgccagcttctgggaatcctgtggcatttcattcaccggcttttctctcccctcccag
GACACCATATCTCAGAAGACGGTAGAGATTGCATCTCCTGCAAATATGGACAGGACTATA
GCACTCACTGGAATGACCTCCTTTTCTGCTTGCGCTGCACCAGGTGTGATTCAG
gtacagaacatatggaccccatgcctaaaggtggaatgcggggtgatgacataaaagttg
tagctaaaatgggatcaggagacctagattctggtccaccttggtcttcatcataccatg
ttccatgattttgtctttgagctttttaataaataaaacaggcccggcacagtggctcat

 1.05 Intr +  40659  40770  112  1  1   53   76   148 0.990   9.54
ttagtgacagctgaagggtgggtatcctgaatgagccatgagtgtgctggtgcagaaact
ggccctcagaactccttggcaaactgagttgagctgagtagcagggtcttggggtgggga
ggaagggtcaagggacacatcaggaaaacacattcccaaaaccttatgctctgtcgtcag
GTGAAGTGGAGCTAAGTCCCTGCACCACGACCAGAAACACAGTGTGTCAGTGCGAAGAAG
GCACCTTCCGGGAAGAAGATTCTCCTGAGATGTGCCGGAAGTGCCGCACAGG
gtgagacaggagccgggggctcccagtagctccatggaaccccaaaagacccaagtctcc
ttgtacccctgtctctcccctgacagcacccgcaaggggcatccttgaggctgtggctgc
ccctcctggtccctctgcgtgtcaccacccctgccccctgcagcagcctctttccacccc

 1.06 Intr +  41778  41851   74  0  2   84   87    45 0.950   3.05
gctcagacccttccccagcctcaagaagggagcacagggggacccactgctgacacgagg
agactgtccttcccctgacaccttctcagggacactggggagggagggtggctcctcttt
catcccacctggccagctttccatcaagagtcccccctctccctctgtgtgtgtacccag
GTGTCCCAGAGGGATGGTCAAGGTCGGTGATTGTACACCCTGGAGTGACATCGAATGTGT
CCACAAAGAATCAG
gtacaaagcacagtggggaagtcccagctgtggaggagacggtgacctccagcccaggga
ctcctgcctctccctgttctctctcaggcatcatcataggagtcacagttgcagccgtag
tcttgattgtggctgtgtttgtttgcaagtctttactgtggaagaaagtccttccttacc

 1.07 Intr +  41939  42049  111  0  0  118   96    56 0.972   9.75
cctctgtgtgtgtacccaggtgtcccagagggatggtcaaggtcggtgattgtacaccct
ggagtgacatcgaatgtgtccacaaagaatcaggtacaaagcacagtggggaagtcccag
ctgtggaggagacggtgacctccagcccagggactcctgcctctccctgttctctctcag
GCATCATCATAGGAGTCACAGTTGCAGCCGTAGTCTTGATTGTGGCTGTGTTTGTTTGCA
AGTCTTTACTGTGGAAGAAAGTCCTTCCTTACCTGAAAGGCATCTGCTCAG
gtaggtgctggctgagggcgggggcacagggcactctctgccctgccccctcccacccta
ttcccacagacagaaacgcctgcccctgccccaagtctaagtgcctccagcctggctcta
tcctcctcctcgtggtcacccccatccccacatcccgtgcaccccccaggaccctggtct

 1.08 Intr +  42627  42658   32  1  2  101   70    45 0.989   1.85
cccttctcatcccccttcctcagggtgtctctgagttgtaaggccccattctgtccccag
ccccagggctccttgtccagtgtcccagcccccagcccagccctgcgccccactgtcctc
tgggaggggggtgcttcatgggcccctcccttcctgctaaggagactgcttcttttttag
GTGGTGGTGGGGACCCTGAGCGTGTGGACAGA
gtgagttgatttctccaggagctgggggctcaggggttcaggaactgcttcctgggacag
cagaacctgggtgggtgggtccccattgtcctcatggctgccctgactctctgaagtggc
ctgggtgctctgggctgactgtgggggacacatggccattttgagcaccacataggctgg

 1.09 Intr +  43092  43247  156  2  0  100  105   134 0.990  16.51
acagcactgggggcctggccccagcagcgggtcctggatgtgctgagtctgggctgcctg
cggtgacctcactgagagggggtggggatgtcaggtgcagctgcatactgaggaccctgc
agcgagccctaggtgtggactcctgagtcggctttttgccttcccaatgtctttttccag
AGCTCACAACGACCTGGGGCTGAGGACAATGTCCTCAATGAGATCGTGAGTATCTTGCAG
CCCACCCAGGTCCCTGAGCAGGAAATGGAAGTCCAGGAGCCAGCAGAGCCAACAGGTGTC
AACATGTTGTCCCCCGGGGAGTCAGAGCATCTGCTG
gtgagtgggggacagatcattttgtttcctggcatgctgctcacctgggatttcgtagac
agtgggagagggcagtgccttagctctcctggcccaggggaaatggaacctgaaggagcc
aggggactgcaggggatggagcagctgcactgaggtggtgaccgtgccagtctgcaggac

 1.10 Intr +  46120  46192   73  0  1   91   89    21 0.844   1.48
gctgtatcggcctccttccgagagtcttgcccctttgtctcctgtcttgttgccagacct
ttcagaacaatgttctggaagtgacgtgctgcaggtctcagagctggctggtggtcgggg
tcagtactggactgtaggactcctggctctgaccaggacattccccactatgtgttacag
GAACCGGCAGAAGCTGAAAGGTCTCAGAGGAGGAGGCTGCTGGTTCCAGCAAATGAAGGT
GATCCCACTGAGA
gtaagtgttttgctcctggagatgcagcaggaatggagggaatagggacagggtcctaac
tgctgtccccagaggtcagagggctcttccagagtattccatgctggaagccgtgggtcc
tgtgctatagaccatctggaccctaaactgtcttctcccatctcttctccccactctacc

 1.11 Intr +  47396  47683  288  0  0   76   90   286 0.744  24.82
gaggccaggcagtgtgggcgcgctctctgtggatgggaagcgggtgggcactggagcggc
aggtttgcccgcacacggggctctccaggttccccgccttgggttctgggcctgatgtgg
aatcctctgccctttctgagtcccaactcacctggctgtctctgtggctttctccaccag
CTCTGAGACAGTGCTTCGATGACTTTGCAGACTTGGTGCCCTTTGACTCCTGGGAGCCGC
TCATGAGGAAGTTGGGCCTCATGGACAATGAGATAAAGGTGGCTAAAGCTGAGGCAGCGG
GCCACAGGGACACCTTGTACACGATGCTGATAAAGTGGGTCAACAAAACCGGGCGAGATG
CCTCTGTCCACACCCTGCTGGATGCCTTGGAGACGCTGGGAGAGAGACTTGCCAAGCAGA
AGATTGAGGACCACTTGTTGAGCTCTGGAAAGTTCATGTATCTAGAAG
gtaatgcagactctgccatgtcctaagtgtgattctcttcaggaagtcagaccttccctg
gtttaccttttttctggaaaaagcccaactggactccagtcagtaggaaagtgccacaat
tgtcacatgaccggtactggaagaaactctcccatccaacatcacccagtggatggaaca

Predicted peptide sequence(s):


>TNFRSF10B_1|GENSCAN_predicted_peptide_1|490_aa
XLKPTGLRDYKSVPYRHGTTGTERPGRFGGPEKARPRTQGGAGSQAWAPGPQDPCARCRR
GPAVVEKGTCRFAHKQPSGGSPGETSPDSCWDPPEDCLIASYQPLNAALSLSSGWRLFCS
QTKLRVGLPNNEMQIPGHMNPSNGRSNRMYWRIIQSIDSLLENLVAALQGHHISEDGRDC
ISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCR
KCRTGCPRGMVKVGDCTPWSDIECVHKESGIIIGVTVAAVVLIVAVFVCKSLLWKKVLPY
LKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNML
SPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGL
MDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLL
SSGKFMYLEX