GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:24:00

Sequence STAR_1 : 9692 bp : 50.35% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1327   1390   64  0  1   68   84    55 0.261   4.41
gccttcagcgggggacatttaagacgcagaacaccaggtccaggctgcagctgcgggact
cagaggcgaagcttgaggggctcaggaaggacgaagaaccacccttgagagaagaggcag
cagcagcggcggcagcagcagcggcagcgaccccaccactgccacatttgccaggaaaca
ATGCTGCTAGCGACATTCAAGCTGTGCGCTGGGAGCTCCTACAGACACATGCGCAACATG
AAGG
gtgagcgctgcgggaaggaggcgatgaggggttggccagctctcagcggatgaggctcag
gccacccaattctgatcctagttgtgcctcttactgggtgaacctgggcaagtttcttcc
cttcttgaatctcagttttcccctcggaagaagtgggctggttactaagatatatccctt

 1.02 Intr +   3391   3504  114  2  0   72  123    80 0.370  10.32
ctgccatgggagttgagggcctggctctagttcaggtccctgctagaatcctgtgtgctc
ctgagcaagtcacttccctctccaaaccaacttactcatttgagacaagatgagggggtg
ggagtggtccatctctaaggggctttccagctcctagacaagggttattcccttctgcag
GGCTGAGGCAACAGGCTGTGATGGCCATCAGCCAGGAGCTGAACCGGAGGGCCCTGGGGG
GCCCCACCCCTAGCACGTGGATTAACCAGGTTCGGCGGCGGAGCTCTCTACTCG
gtaagtgctgaggcttctgggctcctggtgctgctggcaggaggttccctggagggtgat
gtggtgcatgtggctttggctcccctcctgccattccttcattttgagaggacgtcccca
gcctagagttcctcaaggccagatccctctctggtcacctggggcggctgtgattaactc

 1.03 Intr +   3818   3945  128  0  2   58  111   134 0.982  13.10
caaggccagatccctctctggtcacctggggcggctgtgattaactcgaccagcaggctg
gcccctatggctttagtccgggctcttcagagcaatgagcagacccagagctccagggat
gagagctggtggaggctgggagaagaaggaagctctgtctctcctcggctgtgtatccag
GTTCTCGGCTAGAAGAGACTCTCTACAGTGACCAGGAGCTGGCCTATCTCCAGCAGGGGG
AGGAGGCCATGCAGAAGGCCTTGGGCATCCTTAGCAACCAAGAGGGCTGGAAGAAGGAGA
GTCAGCAG
gtaagtgtcggggagaagcctgtggttcctccatgctccactgccatcctcaaggccagc
tggggttactatttttcccagaattcctgtctcatgcagcagtcactgggtagcaagtgg
ttttatcttgagaactctcctttctcgagaatatatcctcagataatgctcttcccccat

 1.04 Intr +   5698   5856  159  0  0  104  105   313 0.849  34.78
aattttgtagttttagtagagacggggtttcaccatcttggccaggctggtctcgaactc
ctgaccttgtgatccacccaccttggcctcccaaagtgctgggattataggcgtgaacca
ccatgcccggccaagaatatttttgtctaaccaccttctgggggctcctttctctgacag
GACAATGGGGACAAAGTGATGAGTAAAGTGGTCCCAGATGTGGGCAAGGTGTTCCGGCTG
GAGGTCGTGGTGGACCAGCCCATGGAGAGGCTCTATGAAGAGCTCGTGGAGCGCATGGAA
GCAATGGGGGAGTGGAACCCCAATGTCAAGGAGATCAAG
gtgagcaaagtccaggtgcaggtggcaggggcccaggagagcccagtgtgaatgctgtat
caaagagaggacccctagctgtggggggtgcttagcccaacacaggctgagtcgtgattc
tggttccccatggcctggtaggtcctgcagaagatcggaaaagatacattcattactcac

 1.05 Intr +   5998   6182  185  0  2   50   90   236 0.995  18.59
gcaatgggggagtggaaccccaatgtcaaggagatcaaggtgagcaaagtccaggtgcag
gtggcaggggcccaggagagcccagtgtgaatgctgtatcaaagagaggacccctagctg
tggggggtgcttagcccaacacaggctgagtcgtgattctggttccccatggcctggtag
GTCCTGCAGAAGATCGGAAAAGATACATTCATTACTCACGAGCTGGCTGCCGAGGCAGCA
GGAAACCTGGTGGGGCCCCGTGACTTTGTGAGCGTGCGCTGTGCCAAGCGCCGAGGCTCC
ACCTGTGTGCTGGCTGGCATGGCCACAGACTTCGGGAACATGCCTGAGCAGAAGGGTGTC
ATCAG
gtaatacgggcagcaggctccaaacccccctcttctaacacaggcctgcaggtgtgcacc
caagcatgtggactgcatccccagctccaagaaaccaacccttggtgcacccatggcttc
cttctacaaaagaagatacttatttaccaaaggagggacaaagacaagataggccctact

 1.06 Intr +   6830   6923   94  2  1   90   67    27 0.460   0.77
ctgatgagctggtaactgtgccaactgccaaataattaccctttgcaaagggcacttccc
tgatgagactcagaaaagacaaggtaccgtagaaacgtgttatctatggtactggtgtaa
gcagccagtgcaagagagaactcgcaactgtcctcctgacttgacttctccatttgccag
GGCGGAGCACGGTCCCACTTGCATGGTGCTTCACCCGTTGGCTGGAAGTCCCTCTAAGAC
CAAACTTACGTGGCTACTCAGCATCGACCTCAAG
gtgaagggcatgggagggggacctggaaggcaggtggtagtgagaaaaacaggctcttcc
cattccccccatgctgcagaaagaatcctcttctattctgatagaatcacaggctgtaag
acagggaagggtctggagtgatggcctaactgctactctaccatctccaaagcctgtgat

 1.07 Term +   7759   7872  114  0  0   64   49   162 0.931   8.47
gaaagtcatgacagcagaggagcaatgcagtcctcccgcccttgactgggcaactccaag
gctgcacctattaacagagctcgaagaccaagcccctggcagcctgtttgtgatagggtg
cagtgtcaagagtgggccaaaacccacaagatggccaaattctcctacctcctactgcag
GGGTGGCTGCCCAAGAGCATCATCAACCAGGTCCTGTCCCAGACCCAGGTGGATTTTGCC
AACCACCTGCGCAAGCGCCTGGAGTCCCACCCTGCCTCTGAAGCCAGGTGTTGA
agaccagcctgctgttcccaactgtgcccagctgcactggtacacacgctcatcaggaga
atccctactggaagcctgcaagtctaagatctccatctggtgacagtgggatgggtgggg
ttcgtgtttagagtatgacactaggattcagattggtgaaagtttttagtaccaagaaaa

Predicted peptide sequence(s):


>STAR_1|GENSCAN_predicted_peptide_1|285_aa
MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLG
SRLEETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF
RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVG
PRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT
WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC