GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:30:37

Sequence PLAT_1 : 34839 bp : 48.79% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    741    784   44  2  2   78   99    35 0.680   3.52
cttaagggctgatggctttgatcgaatttcaggcatgttggccccaaggccctgtgtata
ttccctgggcccactcaaggggatgctggagccggaaagtccccggaggccacctactgc
agccctgcactttacaaagaagagaaagattctccctaaaattacagaacagggccaaag
ATGCCTACCGGAGCAAACCCCCATGGGGGCACCTCCTACCGCAG
gtgagcccaaggctggtcctgccttctcagtggctacccccctgagctcccgccaccaca
caaagtgttccaatccttgtgcatcctccagtccttttaacctctcatgtcctgagaggc
cagagctacagccacagattccagaagacaccccactcccagccccaacctgctgccttt

 1.02 Intr +  11223  11410  188  0  2  133   61   109 0.662  12.03
aggacagcacattaattatttttcagtcatttttaccttatgcgaacaagctgattagtt
cctttcctaggagctggtttttatggagggaagatggggccggtagaggcagatagaggg
ggatgtaatacacaggcactgagacagcaccccactgactttcccctgtccctcctccag
CTGGCCTCCTCCTTTCCAGGGGCTGTGCCCAATCCAGAATCAGTTACTCACTGGTGCCCA
TCGACCATCATTTCCCCATGTGGCCACCAAAGAAATGAACACCACCTTTCTGGTTGGCAT
GATCATCAATTTCTCAGCCAAAACGGCATGCATCCTTGGCTCTGGGAAACAGTACATCTC
CCAGGAAA
gtgagcttacagcacggtaccccacttcctggttaccagactattgttcccgttttcccc
aagaacagtcatcattcacaggttgtttggcagggcccaggaacagagtcactctggttg
ctacagccaacagaccaaacacggcttccaggcaggaaggtcagagctgctctgcaggat

 1.03 Intr +  15666  15851  186  1  0  118   31   101 0.249   7.06
ttttgcaacaataaaaaatatgtagtttctagaatcctcttctagatgcatgtctggcgt
ttctgccgcggggctggcactggaggaagccagacaggacaacattgcggcttatcctcc
tctgttgccatcatggacctctcgcaccccgtgatcaagctgttttttctctccttccag
AATTTAAGGGACGCTGTGAAGCAATCATGGATGCAATGAAGAGAGGGCTCTGCTGTGTGC
TGCTGCTGTGTGGAGCAGTCTTCGTTTCGCCCAGCCAGGTTGGTGTGCAGGATCCCTGTG
TCCCGCCCCTCAAGGCTGTGATGCTTCCGGAGGCTCCAGGGGTCTGTGTCCATCTGGGCC
ACGGAG
gttggaatgctgtcagggagcagagaggcacagggacgaggggctggcattgctgtggag
cacacagcacacactcccttctgtacagcaaactctgtatttgggggcccagtgtgtagc
tgggccctaggcacttattttgacctgagtaagcggaattaacatgccactccctgcctg

 1.04 Intr +  19806  19943  138  1  0   89   53    49 0.770   1.94
gtcaccgtgtttggccagtattcattatcttgttgtcttccagttgtgtctcttcaataa
gggagtatgcaatggagtctatagaaagcaagtgagggagttttctcagtaggtgcaagg
gtagtgaggcatttcattttgagtcatactctgatgaggctggcctgtcttttctcatag
TGATCTGCAGAGATGAAAAAACGCAGATGATATACCAGCAACATCAGTCATGGCTGCGCC
CTGTGCTCAGAAGCAACCGGGTGGAATATTGCTGGTGCAACAGTGGCAGGGCACAGTGCC
ACTCAGTGCCTGTCAAAA
gtatgtactgaggctgggaggtggtgcatgcctgtgatcccagcactttaggaggccaag
gtgggagggtcgctggagcccgggagttcaagaccaatctgggcaaacatagcaagtccc
ctgtctctacaaaaaataaaaaaattagccagacctggtatgtagtcccaactacttggg

 1.05 Intr +  20861  20971  111  0  0   77   95   149 0.999  14.85
atttttttcaaccaaaggcaggatgaaaacagtatttgtaggatgcagaactggtatacg
cgtgttccacgctgcaggacttgagtgtgtgtggattgtggtagacagggctcctggaac
catggcctgagcacacagaaggaggctgtcattaggggcttccttttttatacttgacag
GTTGCAGCGAGCCAAGGTGTTTCAACGGGGGCACCTGCCAGCAGGCCCTGTACTTCTCAG
ATTTCGTGTGCCAGTGCCCCGAAGGATTTGCTGGGAAGTGCTGTGAAATAG
gtgagtaggtgagagcacgtgaaacgagctgaaatcccacctctccagtctcccccgccc
ccggaaggaaaggcagggtgcgatggcagggccaggggtgggggccagggacagggaagg
cgcttctgccatgggtcaggaagcacagtgccacacagcaagcagagcctaggtgtgacc

 1.06 Intr +  21305  21479  175  0  1   63   94   234 0.999  20.50
cacagcaagcagagcctaggtgtgaccctgaatccaggctggcacccttgccacccagcc
tgtggcttccgagccagcctgcatcaggcctgggggaggacggggcagagaggggagcct
cctgagggctgaatgaaaggggactcccatgtgaggcatccatgccctgctctctgtcag
ATACCAGGGCCACGTGCTACGAGGACCAGGGCATCAGCTACAGGGGCACGTGGAGCACAG
CGGAGAGTGGCGCCGAGTGCACCAACTGGAACAGCAGCGCGTTGGCCCAGAAGCCCTACA
GCGGGCGGAGGCCAGACGCCATCAGGCTGGGCCTGGGGAACCACAACTACTGCAG
gtgagggcacatccccaaggagggattccccctgtgagaagctgctacagctggggaaag
attctgtcagatccgtcagggttctcccaagaaacataaccaatacaggatggatagatg
gatagatgatagacagataatagatgataggtgatagatgatagattgatagatgataga

 1.07 Intr +  23705  23796   92  2  2   77  110    80 0.999   8.74
aacggaggttgcagtgagaggagatgcgccgctgcactccagcctgggataaacagcgag
actctgtcaaaaaaaaaagcaccccccattcctccagaaaaggataccaaagtccttggg
tcctaaaggagaggcttcacctttgacctaccctggcccttcccttggctgatttttcag
AAACCCAGATCGAGACTCAAAGCCCTGGTGCTACGTCTTTAAGGCGGGGAAGTACAGCTC
AGAGTTCTGCAGCACCCCTGCCTGCTCTGAGG
gtaagtggcagccaccccgcctttccctgaatgtccctgggggaggaaagtccaggagga
caggccgatagccctcctgcacctgaggggagaaagggggaggccaggagtgagtcattt
tggttgcagagggaagaaagacaggacttaggtctgtgcctgggcttggcctctgactgg

 1.08 Intr +  25987  26158  172  2  1   94   94   109 0.999  11.10
gatcgcgcattgcactccagcctgggcaacaaaaggggaagtgtgaggtgttacactctt
ctcagtgccgggctagcggcctccagcttcctcgaccggcagctccgcttcaagccccag
ccctgacttgcgtgcttcagaatttgtttttgtttcagtttgagaattcttttcttctag
GAAACAGTGACTGCTACTTTGGGAATGGGTCAGCCTACCGTGGCACGCACAGCCTCACCG
AGTCGGGTGCCTCCTGCCTCCCGTGGAATTCCATGATCCTGATAGGCAAGGTTTACACAG
CACAGAACCCCAGTGCCCAGGCACTGGGCCTGGGCAAACATAATTACTGCCG
gtaggtagcacaggggtggggggttcaggtcttggcagaacgtgggattagggtgtgaga
cgggggaagatccaatgtctcaagttgcatgacagacccagtgcgtgggaagcacccatg
gatattatctaatccaacctcttcacttgctagaataacacatattgtgaaaagcaaggt

 1.09 Intr +  26855  26940   86  2  2   42   59   133 0.999   5.26
actcctggcctggtgtggtggtgcatgcctgtaatcccagcactttgggaggctgaggca
ggaggattgcttgagcccaggagttcaagaccagcctgggcaacatggcaagaccccatc
tctacaaaaattaaaaaataagaagataaaaaggaaaccttaaactctcttatcatttag
GAATCCTGATGGGGATGCCAAGCCCTGGTGCCACGTGCTGAAGAACCGCAGGCTGACGTG
GGAGTACTGTGATGTGCCCTCCTGCT
gtaagggctgggccccggctgcctccctgcacctggtctcccttcttcaccatctcctcg
ccactttctaggccttcatggctgtctggtgcagactgtgtgcctaccagacttccaggc
tgggtggggagggggcttccatgactgaagccacggtgggtgggcgggtgtccatgaccc

 1.10 Intr +  28192  28387  196  2  1  140   75   238 0.999  26.17
ctccgcctcctgaaacttatcgctgtgggaactaaagagaatgtatggacaacattcggc
atgctgatcccaccaagtgaaagttgtggttttacagccatgctgatggcctcctcactc
tacctacacacgtgcaggaggcctgtgggactgactgcctcctcgtcctttcctccccag
CCACCTGCGGCCTGAGACAGTACAGCCAGCCTCAGTTTCGCATCAAAGGAGGGCTCTTCG
CCGACATCGCCTCCCACCCCTGGCAGGCTGCCATCTTTGCCAAGCACAGGAGGTCGCCCG
GAGAGCGGTTCCTGTGCGGGGGCATACTCATCAGCTCCTGCTGGATTCTCTCTGCCGCCC
ACTGCTTCCAGGAGAG
gtaggggctcggaaacccagttggtttttccaccctctaacgcctagaaaccaagccctt
taggggaaatcccacagcaaaaaaagcattctaaggctgtttctccaccaggtttccgcc
ccaccacctgacggtgatcttgggcagaacataccgggtggtccctggcgaggaggagca

 1.11 Intr +  28535  28635  101  2  2   41   91   231 0.609  18.45
gattctctctgccgcccactgcttccaggagaggtaggggctcggaaacccagttggttt
ttccaccctctaacgcctagaaaccaagccctttaggggaaatcccacagcaaaaaaagc
attctaaggctgtttctccaccaggtttccgccccaccacctgacggtgatcttgggcag
AACATACCGGGTGGTCCCTGGCGAGGAGGAGCAGAAATTTGAAGTCGAAAAATACATTGT
CCATAAGGAATTCGATGATGACACTTACGACAATGACATTG
gtaagagctcgtcattcccggctccagttcatacagatcacacaacacacccacatgcac
tcacctatgtttacacacacgggcctcctcctccagcccctgcccctcctgcgtgttcct
cccctcccggggacgcggccctcacgccagctcactcctcctttctccctcccagcgctg

 1.12 Intr +  28811  28951  141  0  0  132   95   287 0.999  34.12
cattggtaagagctcgtcattcccggctccagttcatacagatcacacaacacacccaca
tgcactcacctatgtttacacacacgggcctcctcctccagcccctgcccctcctgcgtg
ttcctcccctcccggggacgcggccctcacgccagctcactcctcctttctccctcccag
CGCTGCTGCAGCTGAAATCGGATTCGTCCCGCTGTGCCCAGGAGAGCAGCGTGGTCCGCA
CTGTGTGCCTTCCCCCGGCGGACCTGCAGCTGCCGGACTGGACGGAGTGTGAGCTCTCCG
GCTACGGCAAGCATGAGGCCT
gtaagtggaaggaagtctcggccccatcctgtctgcgggacagcaggggaggctgcggtc
caccagaggaaaatggggtcaggagaccgaagttccagccccgggtcaggcactgacgcc
agtcccgtctccctgtgtcgtgggggcccgtctctgctgtctctgcctcacagggacact

 1.13 Intr +  29814  29980  167  1  2  112   91   110 0.999  13.38
cccggaatcctgctgtttttgtgggtcaaaacgataaaataccagcagtgtcataggatt
cgacctaatacatgttgaatcttgatcaatgttagctattattggaaaatttggctttct
ctttcaaaaacgtttataaataactttccctaaaaccatatgatggttctcccctttcag
TGTCTCCTTTCTATTCGGAGCGGCTGAAGGAGGCTCATGTCAGACTGTACCCATCCAGCC
GCTGCACATCACAACATTTACTTAACAGAACAGTCACCGACAACATGCTGTGTGCTGGAG
ACACTCGGAGCGGCGGGCCCCAGGCAAACTTGCACGACGCCTGCCAG
gtaaccaggagtggcgcgcccatgctgggcacaacccaggggagaatgcccctgggacaa
caggttcttcaccaaagaaaaaagttatcaccagagtggagtgatttcctcttagtgata
cccctggggattctagatgagggcctcacagaataaagcaactggaggaagatcaaagtc

 1.14 Term +  32726  32884  159  1  0  106   47   172 0.990  12.84
tccccagacaggaattgatttttgttttcctcatcaaagttataatgaaatgacactgaa
tggaatattattgaagggcctgctgtattttgaagattacgatgttcatgctacacatac
tgactttctccagatagtctgctttttttgcaaacgccaaacctgctatctcctttgcag
GGCGATTCGGGAGGCCCCCTGGTGTGTCTGAACGATGGCCGCATGACTTTGGTGGGCATC
ATCAGCTGGGGCCTGGGCTGTGGACAGAAGGATGTCCCGGGTGTGTACACCAAGGTTACC
AACTACCTAGACTGGATTCGTGACAACATGCGACCGTGA
ccaggaacacccgactcctcaaaagcaaatgagatcccgcctcttcttcttcagaagaca
ctgcaaaggcgcagtgcttctctacagacttctccagacccaccacaccgcagaagcggg
acgagaccctacaggagagggaagagtgcattttcccagatacttcccattttggaagtt

Predicted peptide sequence(s):


>PLAT_1|GENSCAN_predicted_peptide_1|651_aa
MPTGANPHGGTSYRSWPPPFQGLCPIQNQLLTGAHRPSFPHVATKEMNTTFLVGMIINFS
AKTACILGSGKQYISQEKFKGRCEAIMDAMKRGLCCVLLLCGAVFVSPSQVGVQDPCVPP
LKAVMLPEAPGVCVHLGHGVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCH
SVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTW
STAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYS
SEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQAL
GLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADI
ASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERTYRVVPGEEEQKFEVEK
YIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGK
HEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQG
DSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP