GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:53:03

Sequence OPLAH_1 : 15010 bp : 65.70% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1141   1435  295  0  1   -5   83   431 0.332  31.14
gagccagagacctgggacagttctgggcacccactggccatttggccctcagggggctgg
aggtcagaggtcaggccacctctgccacggggtggttggaacagctgggtcctgaccctg
aaggcccggaatgcggctgaggcgagggggcaggggcagctgctgacctcacaatagcag
GGTCTGCTGTCCCTGGCCGGCCTGCTGGCCCCCGCCAGCTGCCGCCGCTGGCTGCCAGGC
ATGTCCCTCCTCAGCAGCTATGAGGGCCTGCGGCAGGAGATCCAGCGGCTGGCACAGGAG
AACGAAGAGCTGCGGCGGCTGGTGCAGCTCATCCAGGAGAACCAGGAGCTGAAGCTGGTG
CTCAGGAACCGCGGCAGCAGCCTGGGCTTCTGCAGCTCCGGGTTCCTGGCTGAGGTGGCT
GCCAGTCCCTGGCTACCCAGGCGGAGAACGATCAAATTCAAGAATGCTGAGAGAG
gtgagccgtaccggggccccaagactctgtggagttgggcaaacccgctgggtgctgcgg
tgcctctggagcaaagccagggccctggggctcttccaggatgtgcggcggggagaaggt
gccaggtctgggaaagtgacctctgagcagagcctgagcgggcgagggagctgccaggct

 1.02 Intr +   4971   5018   48  1  0   92   99     9 0.745   2.19
gtgcctgctccgctgcctgggtttcggcccagtccagggcccggagaagcgcgatgctgg
gcatgggggcatcaggccgctgaccgccggccaggctctcgctcgggcccaggctgccct
cggagctgggcctgcggctctggctcttcccagagtcgtgcccgtgggtctctccctcag
GAACCCCCCGCATGCGCAGGGCTGGGGAGCCTCTAGTCCCACTCGCAG
gtgagcccgggctgaccccgcctccgtccagtttttccagggctaccagctgaagagctc
ctgtgggactccagccccaccaccatgggcagccccgagggccgcttccactttgccatc
gaccgtgggggtaccttcacagacgtctttgcccagtgcccaggggggcacgtgcgggtc

 1.03 Intr +   5059   5273  215  2  2   74   80   362 0.900  33.65
ggccaggctctcgctcgggcccaggctgccctcggagctgggcctgcggctctggctctt
cccagagtcgtgcccgtgggtctctccctcaggaaccccccgcatgcgcagggctgggga
gcctctagtcccactcgcaggtgagcccgggctgaccccgcctccgtccagtttttccag
GGCTACCAGCTGAAGAGCTCCTGTGGGACTCCAGCCCCACCACCATGGGCAGCCCCGAGG
GCCGCTTCCACTTTGCCATCGACCGTGGGGGTACCTTCACAGACGTCTTTGCCCAGTGCC
CAGGGGGGCACGTGCGGGTCTTAAAACTGCTCTCAGAGGACCCTGCCAACTATGCGGACG
CGCCAACCGAAGGCATCCGCCGCATCCTGGAGCAG
gtgggccagggcggagcgggtggacagggaccccacggccagaagccccacactgaccac
gtggtccccaggaggccggcatgctcctgccccgggaccagccgctggactccagtcata
tcgccagcatccgcatgggcaccacagtggccaccaacgcactgctggagcggaaggggg

 1.04 Intr +   5345   5536  192  1  0   49   93   406 0.996  38.10
ctttgcccagtgcccaggggggcacgtgcgggtcttaaaactgctctcagaggaccctgc
caactatgcggacgcgccaaccgaaggcatccgccgcatcctggagcaggtgggccaggg
cggagcgggtggacagggaccccacggccagaagccccacactgaccacgtggtccccag
GAGGCCGGCATGCTCCTGCCCCGGGACCAGCCGCTGGACTCCAGTCATATCGCCAGCATC
CGCATGGGCACCACAGTGGCCACCAACGCACTGCTGGAGCGGAAGGGGGAGCGGGTGGCG
CTGCTGGTGACACGTGGCTTCCGAGACCTGCTGCACATTGGCACCCAAGCCCGTGGGGAC
CTCTTTGACCTG
gtgagctccatgttggctggggaccaggctgtgtggtgtacaccccccagggatgccttg
accctgtggggagagcagttgttggattagtgatggctcatgggcaccagccgacaaaga
ggaagctcccgaattcccagtgggaccccaagttctcctagccctcggagtgggcacagg

 1.05 Intr +   6056   6155  100  1  1  100   93   145 0.999  17.05
tgcctagggggtggagagctgcccccttggtgagccttgctggggctgccaggtatgact
ctcctgggcctgccgaccggcctgttgggacacagccactcacctgtaccacccactcac
acaggaccccggcctggaccctcaggcctgggcctcttctgagtctctgcccgcccccag
GCCGTGCCCATGCCTGAGGTGCTGTATGAAGAGGTGCTGGAGGTGGACGAACGCGTGGTG
CTGCACCGTGGAGAGGCGGGCACCGGGACGCCTGTGAAAG
gtgtgtgtgccgccgctgctgtgggatttggggccggagggtcctgctggcctttaacgg
ggcctcctgggcttttctggaaggccgcacgggggacctgctggaagtgcagcagcctgt
ggacctgggggccctgcgtgggaagctggaggggctgctatctcgaggcatccgcagcct

 1.06 Intr +   6239   6362  124  0  1   25   94   161 0.999  11.22
gtgcccatgcctgaggtgctgtatgaagaggtgctggaggtggacgaacgcgtggtgctg
caccgtggagaggcgggcaccgggacgcctgtgaaaggtgtgtgtgccgccgctgctgtg
ggatttggggccggagggtcctgctggcctttaacggggcctcctgggcttttctggaag
GCCGCACGGGGGACCTGCTGGAAGTGCAGCAGCCTGTGGACCTGGGGGCCCTGCGTGGGA
AGCTGGAGGGGCTGCTATCTCGAGGCATCCGCAGCCTGGCTGTGGTGCTCATGCACTCGT
ACAC
gtgagtgaggtggggctgtgggctgcgggagcaggtgccgggcctggtgggagacgaggt
gccactgggtttttgtcataggtgggcccagcatgagcagcaggtgggtgtgctggcccg
ggagctgggcttcacgcacgtgtcactgtcctcggaggccatgcccatggtgcgcatcgt

 1.07 Intr +   6444   6639  196  0  1   55  100   286 0.999  27.13
gcagcagcctgtggacctgggggccctgcgtgggaagctggaggggctgctatctcgagg
catccgcagcctggctgtggtgctcatgcactcgtacacgtgagtgaggtggggctgtgg
gctgcgggagcaggtgccgggcctggtgggagacgaggtgccactgggtttttgtcatag
GTGGGCCCAGCATGAGCAGCAGGTGGGTGTGCTGGCCCGGGAGCTGGGCTTCACGCACGT
GTCACTGTCCTCGGAGGCCATGCCCATGGTGCGCATCGTCCCTCGGGGGCACACGGCCTG
TGCCGACGCCTACCTCACGCCCGCCATCCAGCGCTACGTGCAGGGCTTCTGCCGTGGCTT
CCAGGGCCAACTCAAG
gtgaggctgtgaggcacccccactgcccactcctgggcctgggcctgggccttggcctgc
ccctcatggcccgcctgctgcccgctcgcaggatgtgcaggtgttgttcatgcgctccga
tggcggcctggcgcccatggacaccttcagcggctccagtgctgtgctctcgggcccggc

 1.08 Intr +   6731   6896  166  1  1  101   64   273 0.997  26.93
ggcacacggcctgtgccgacgcctacctcacgcccgccatccagcgctacgtgcagggct
tctgccgtggcttccagggccaactcaaggtgaggctgtgaggcacccccactgcccact
cctgggcctgggcctgggccttggcctgcccctcatggcccgcctgctgcccgctcgcag
GATGTGCAGGTGTTGTTCATGCGCTCCGATGGCGGCCTGGCGCCCATGGACACCTTCAGC
GGCTCCAGTGCTGTGCTCTCGGGCCCGGCCGGCGGCGTGGTGGGCTACTCAGCCACCACC
TACCAGCAGGAGGGTGGCCAGCCTGTCATCGGCTTTGACATGGGAG
gtatgagggccgagggctggggtctcggggaggctcagctgctgggcccctgggtcttca
agtgacccaccagcaccccacccctgccaggcacgtccacggatgtgagccgctatgctg
gggaattcgagcacgtcttcgaggccagcacagctggcgtcaccctccaggccccgcagc

 1.09 Intr +   6987   7125  139  1  1   50   76   229 0.999  18.60
tctcgggcccggccggcggcgtggtgggctactcagccaccacctaccagcaggagggtg
gccagcctgtcatcggctttgacatgggaggtatgagggccgagggctggggtctcgggg
aggctcagctgctgggcccctgggtcttcaagtgacccaccagcaccccacccctgccag
GCACGTCCACGGATGTGAGCCGCTATGCTGGGGAATTCGAGCACGTCTTCGAGGCCAGCA
CAGCTGGCGTCACCCTCCAGGCCCCGCAGCTGGACATCAACACCGTGGCAGCGGGAGGGG
GTTCCCGCCTCTTCTTCAG
gtcagctctcctgcttcccaggctgggaccccagccctgtctccctcctcgtgtccaact
ccaaccccagcccttccttcccctaggtctggcctctttgtggttgggcccgagtcagca
ggagcccacccaggacccgcctgctaccgcaaaggtaagagtcaggatctggccggcctg

 1.10 Intr +   7212   7279   68  0  2  118  116    69 0.998  12.40
tcttcgaggccagcacagctggcgtcaccctccaggccccgcagctggacatcaacaccg
tggcagcgggagggggttcccgcctcttcttcaggtcagctctcctgcttcccaggctgg
gaccccagccctgtctccctcctcgtgtccaactccaaccccagcccttccttcccctag
GTCTGGCCTCTTTGTGGTTGGGCCCGAGTCAGCAGGAGCCCACCCAGGACCCGCCTGCTA
CCGCAAAG
gtaagagtcaggatctggccggcctggccttgccctccgcttgccgccgcaggcccagcc
cctcctgtcagccctatccctgctgcctactcctgctcccctgcctccagcccccaagcc
ccacaccctgtccacctcccagggggccctgtgacagtgacggatgctaatctggtcctg

 1.11 Intr +   7422   7687  266  1  2   88   98   301 0.854  29.58
agcaggagcccacccaggacccgcctgctaccgcaaaggtaagagtcaggatctggccgg
cctggccttgccctccgcttgccgccgcaggcccagcccctcctgtcagccctatccctg
ctgcctactcctgctcccctgcctccagcccccaagccccacaccctgtccacctcccag
GGGGCCCTGTGACAGTGACGGATGCTAATCTGGTCCTGGGTCGCCTGCTGCCTGCCTCCT
TCCCCTGCATTTTTGGGCCGGGAGAGAACCAACCACTTTCCCCTGAGGCCTCCCGCAAAG
CCCTGGAGGCTGTGGCCACTGAGGTCAACAGCTTCCTGACCAACGGGCCCTGCCCGGCCT
CCCCGCTGAGCCTGGAGGAGGTGGCCATGGGGTTCGTGCGCGTGGCCAACGAGGCCATGT
GCCGGCCCATCCGTGCACTCACGCAG
gtacgtccacctctgctctcccgcctgtcctgcccccagccctgctccctgccccaggcc
tcctgctcaggctgggggctggatggggtagagtaggagagcccactgaccccttctgtc
tccctaggcaagaggccatgacccctcagcccatgtgctggcctgctttgggggagctgg

 1.12 Intr +   7815   7927  113  2  2   97   80    95 0.984   9.95
tcgtgcgcgtggccaacgaggccatgtgccggcccatccgtgcactcacgcaggtacgtc
cacctctgctctcccgcctgtcctgcccccagccctgctccctgccccaggcctcctgct
caggctgggggctggatggggtagagtaggagagcccactgaccccttctgtctccctag
GCAAGAGGCCATGACCCCTCAGCCCATGTGCTGGCCTGCTTTGGGGGAGCTGGTGGGCAG
CATGCATGTGCCATCGCCCGGGCCCTGGGCATGGACACGGTGCACATCCACAG
gtgggcctgggtgtgggtgcacggaggtggtgtgatctgcgccgggcttgggaggtgacc
tcccattgccatgctgcccatccctgcaggcacagtgggctgctgtcggccctggggctg
gccctggctgacgtggtgcatgaggcacaggaaccctgctccctgctctacgcgcctgag

 1.13 Intr +   8017   8187  171  1  0   92   80   257 0.996  25.56
cccatgtgctggcctgctttgggggagctggtgggcagcatgcatgtgccatcgcccggg
ccctgggcatggacacggtgcacatccacaggtgggcctgggtgtgggtgcacggaggtg
gtgtgatctgcgccgggcttgggaggtgacctcccattgccatgctgcccatccctgcag
GCACAGTGGGCTGCTGTCGGCCCTGGGGCTGGCCCTGGCTGACGTGGTGCATGAGGCACA
GGAACCCTGCTCCCTGCTCTACGCGCCTGAGACCTTCGTGCAGCTGGACCAGAGGCTGAG
CCGCCTGGAGGAGCAGTGTGTGGATGCTCTGCAGGCCCAGGGCTTCCCCAG
gtgggctcccagggtgccctggacagagggcttacgttgtcctcaccacgcccttggtgg
gtgttcctcctgatgacttcccaggtggtcccggggtgtgcgagaagcagaacaggtgtc
cttgccgggcgctgggtggggtggggtcagggcagggggtttggtgtgagtgcccccaac

 1.14 Intr +   8380   8517  138  1  0   70   88   175 0.998  16.46
ggtgccctggacagagggcttacgttgtcctcaccacgcccttggtgggtgttcctcctg
atgacttcccaggtggtcccggggtgtgcgagaagcagaacaggtgtccttgccgggcgc
tgggtggggtggggtcagggcagggggtttggtgtgagtgcccccaaccacctgctgcag
GTCCCAGATCAGCACTGAGAGCTTCCTGCACCTGCGCTACCAGGGCACGGACTGTGCTCT
GATGGTGTCTGCCCACCAGCACCCAGCCACAGCCCGCTCGCCCCGTGCGGGGGACTTCGG
GGCAGCCTTTGTGGAGCG
gtacgtggcttcctgactccggatccctggcaaggggccctcctgtctggccgcctcact
ctgaccactccttgggtccccgcggggagtgcaggtacatgagggagtttggctttgtca
tacctgagcggccggtggtcgtggacgatgtgcgagtgcggggcaccggccgcagtggtc

 1.15 Intr +   8612   8750  139  2  1   -8   81   251 0.747  16.45
tgtgctctgatggtgtctgcccaccagcacccagccacagcccgctcgccccgtgcgggg
gacttcggggcagcctttgtggagcggtacgtggcttcctgactccggatccctggcaag
gggccctcctgtctggccgcctcactctgaccactccttgggtccccgcggggagtgcag
GTACATGAGGGAGTTTGGCTTTGTCATACCTGAGCGGCCGGTGGTCGTGGACGATGTGCG
AGTGCGGGGCACCGGCCGCAGTGGTCTTCGCCTCGAGGATGCCCCCAAAGCCCAGACCGG
GCCTCCCCGGGTGGACAAG
gttggtggtcctgcctgtgccagcctgacagcacccatggggcaccgggatggggaccaa
gccctgtgagaggcatcggggagggtgctgggcccgggcgctgtactcacccgcaccctc
tgcagatgacccagtgctactttgaggggggctaccaggagacccctgtgtacctgctgg

 1.16 Intr +   8876   8988  113  1  2   99   80   198 0.985  20.45
tcttcgcctcgaggatgcccccaaagcccagaccgggcctccccgggtggacaaggttgg
tggtcctgcctgtgccagcctgacagcacccatggggcaccgggatggggaccaagccct
gtgagaggcatcggggagggtgctgggcccgggcgctgtactcacccgcaccctctgcag
ATGACCCAGTGCTACTTTGAGGGGGGCTACCAGGAGACCCCTGTGTACCTGCTGGCAGAG
CTGGGCTATGGGCACAAGCTCCATGGGCCCTGCCTCATCATCGACAGTAACAG
gtgggctgaagtccggccagggtggaggatgtggacgggtccactgcggggcccctggtg
cagggttctctggcccaaggctgcaggggcctgcaggactctgtatcccaccatcgttgg
ggtggcccctggcctggggccgtggcatctctggttggaggggtgtcgcctggccccatg

 1.17 Intr +   9196   9347  152  1  2  112  105   181 0.984  23.20
gatgtggacgggtccactgcggggcccctggtgcagggttctctggcccaaggctgcagg
ggcctgcaggactctgtatcccaccatcgttggggtggcccctggcctggggccgtggca
tctctggttggaggggtgtcgcctggccccatgcagccctctgtgccctctgctccccag
CACCATCCTGGTGGAGCCAGGTTGCCAGGCAGAGGTGACCAAGACAGGGGACATCTGCAT
CTCCGTGGGGGCCGAAGTCCCCGGCACAGTGGGCCCCCAGCTGGACCCTATCCAGCTGTC
CATCTTCTCACACCGCTTCATGAGCATTGCTG
gtgagtggccgctgccaggctccctgtgggatgaggcgccggctgtgtcatggggtagct
ggcagggctgtgcccaaagggagaggcagaagcaggaccccctggcgacggggcgggcag
tgtggccgcagcactggtgtggtgcagttggccatgagaacaaaccttgggcagggagga

 1.18 Intr +   9946  10106  161  2  2   61   37   274 0.930  20.50
ctttacataggctaagacgtggccaagtgggcacaccgtcaacttggtcttccccaggaa
aaagctgctgggtttttcctgggtcctgggtttgagtcctggtgggtcctgttcctccct
ttcctggggccaggctgtgggtgggtggggccagcgggcctggtcactttgtgctcctag
AGCAGATGGGCCGCATCCTGCAGCGCACAGCCATCTCCACCAACATCAAGGAGCGTCTGG
ACTTCTCCTGTGCCCTCTTTGGGCCCGATGGGGGGCTGGTGTCCAATGCCCCCCACATCC
CTGTGCACCTGGGTGCCATGCAGGAGACGGTGCAGTTCCAG
gtggcccttcccccgcctcacccttccatccccctccctcaccctccaccccccccccac
cccgctctggcccctgctcccctgtgcccactctgcacccatctcctggtttcagattca
gcacctgggggccgatctccaccctggcgacgtgctactgagcaaccatcccagtgccgg

 1.19 Intr +  10222  10323  102  0  0  112   93    75 0.997  11.94
tggtgtccaatgccccccacatccctgtgcacctgggtgccatgcaggagacggtgcagt
tccaggtggcccttcccccgcctcacccttccatccccctccctcaccctccaccccccc
cccaccccgctctggcccctgctcccctgtgcccactctgcacccatctcctggtttcag
ATTCAGCACCTGGGGGCCGATCTCCACCCTGGCGACGTGCTACTGAGCAACCATCCCAGT
GCCGGGGGCAGCCACCTGCCAGACCTGACTGTTATCACACCG
gtgaggggtgctgcccgcctgcctctgctggggcagtggtggccgatgcagctgaccgtg
gctctccacccgctaggtgttttggccgggtcagacgcggcctgtgttctatgtggccag
ccgagggcaccacgcagacatcgggggcatcacaccaggctccatgcccccccactccac

 1.20 Intr +  10400  10574  175  1  1   82   96   144 0.935  15.31
agattcagcacctgggggccgatctccaccctggcgacgtgctactgagcaaccatccca
gtgccgggggcagccacctgccagacctgactgttatcacaccggtgaggggtgctgccc
gcctgcctctgctggggcagtggtggccgatgcagctgaccgtggctctccacccgctag
GTGTTTTGGCCGGGTCAGACGCGGCCTGTGTTCTATGTGGCCAGCCGAGGGCACCACGCA
GACATCGGGGGCATCACACCAGGCTCCATGCCCCCCCACTCCACCATGCTGCAACAGGAG
GGTGCCGTCTTTCTGTCCTTCAAACTTGTCCAGGGGGGCGTCTTCCAGGAGGAGG
gtgagtgggagtggggtggggcaggccttctgtaggctgggacacatggccactgctggc
aagcaggcctggctggaccgtgggatgcagcccataggcccaggcctgccttgaggctgg
gaggagataggtggttaccccaaagggcagctgcagatcggatcccgggagctgagatga

 1.21 Intr +  11742  11926  185  1  2   26   80   361 0.892  29.81
ctgcctcagaggggaccctgagccaggctcaaggagaggggctttcctgaggtgctgagc
agtcccaggccaggcctcggtgctttctaggggccagagaccttgtctggatctgggaaa
cctgggttgggggtgcagacagggttggccaggggctcagtgatgacactgtccatccag
CGGTGACGGAGGCCCTGCGGGCGCCAGGCAAGGTCCCCAACTGCAGCGGAACCAGAAACC
TGCACGACAACCTGTCGGACCTCCGTGCCCAGGTGGCAGCCAACCAGAAGGGCATCCAGC
TGGTGGGGGAGCTCATTGGGCAGTACGGCCTGGACGTGGTGCAGGCCTACATGGGCCATA
TTCAG
gtgggcctgggcacaggagtgtgggcggcagggccatcctgcaggtgacctggccaccac
tgatcctgctccctgccaggcaaacgctgagctggccgtgcgagacatgttgcgtgcctt
tggaacctcccggcaggcccggggcctgcccctggaggtgtcctcggaagaccacatgga

 1.22 Intr +  12006  12152  147  2  0   92   80   195 0.994  20.72
gtgcccaggtggcagccaaccagaagggcatccagctggtgggggagctcattgggcagt
acggcctggacgtggtgcaggcctacatgggccatattcaggtgggcctgggcacaggag
tgtgggcggcagggccatcctgcaggtgacctggccaccactgatcctgctccctgccag
GCAAACGCTGAGCTGGCCGTGCGAGACATGTTGCGTGCCTTTGGAACCTCCCGGCAGGCC
CGGGGCCTGCCCCTGGAGGTGTCCTCGGAAGACCACATGGACGACGGTTCCCCCATCCGC
CTCCGTGTGCAGATCAGCCTGAGTCAG
gtgggccgtggggagagtgcctctaggcggcaggggcacggtgcggccgctgacagcctc
tcccttccctcggggcgcgcagggcagcgccgtgtttgacttcagcggcactgggccgga
ggtgtttggtaatctcaacgcaccgcgggccgtaaccctgtccgccctcatctactgcct

 1.23 Intr +  12235  12369  135  0  0   61   57   248 0.845  20.95
cccggcaggcccggggcctgcccctggaggtgtcctcggaagaccacatggacgacggtt
cccccatccgcctccgtgtgcagatcagcctgagtcaggtgggccgtggggagagtgcct
ctaggcggcaggggcacggtgcggccgctgacagcctctcccttccctcggggcgcgcag
GGCAGCGCCGTGTTTGACTTCAGCGGCACTGGGCCGGAGGTGTTTGGTAATCTCAACGCA
CCGCGGGCCGTAACCCTGTCCGCCCTCATCTACTGCCTGCGCTGTCTGGTGGGCCGCGAC
ATCCCACTCAACCAG
gttcgcaggggtgtgtgcgcgagggggggccccagcccgaggtcaccctgagtgcgcctc
ctgggcccagccacggtctgaccccacgggtgctggggcggggggtggggtgctgtttct
cccggagcccaccccaagagctcctgagagccgcccgccccgcacagggctgcctggcgc

 1.24 Intr +  12537  12686  150  2  0   38   80   253 0.885  21.05
cccactcaaccaggttcgcaggggtgtgtgcgcgagggggggccccagcccgaggtcacc
ctgagtgcgcctcctgggcccagccacggtctgaccccacgggtgctggggcggggggtg
gggtgctgtttctcccggagcccaccccaagagctcctgagagccgcccgccccgcacag
GGCTGCCTGGCGCCAGTGCGCGTGGTCATTCCCCGAGGCTCCATCCTGGACCCGTCGCCC
GAGGCGGCGGTGGTGGGCGGCAACGTGCTCACGTCGCAGCGCGTGGTGGATGTCATCCTG
GGGGCCTTTGGGGCCTGCGCCGCCTCCCAG
gtgcgggggcggggtgggcgcagctcgggggcggactgggtgggcaggctggagtaggag
cgggagggcgaggtggggacgccctgccccagcccagcgcagcgaccaggtgccctcacc
agggctgcatgaacaacgtgaccctgggcaacgcccacatgggctactacgagacggtgg

 1.25 Intr +  12809  12966  158  1  2   26  105   250 0.800  20.50
gtcgcagcgcgtggtggatgtcatcctgggggcctttggggcctgcgccgcctcccaggt
gcgggggcggggtgggcgcagctcgggggcggactgggtgggcaggctggagtaggagcg
ggagggcgaggtggggacgccctgccccagcccagcgcagcgaccaggtgccctcaccag
GGCTGCATGAACAACGTGACCCTGGGCAACGCCCACATGGGCTACTACGAGACGGTGGCG
GGCGGCGCGGGCGCGGGTCCCAGCTGGCACGGGCGCAGCGGTGTGCACAGCCACATGACC
AACACACGCATCACCGACCCTGAGATCCTGGAGAGCCG
gtgagcggcgtgcgcggaggctgggggcacggccgggtgggagccggggctcgggccacg
ctgagtctttgccctcgtcctcgccctcgcaggtacccggtcatcctgcgccgcttcgag
ctgcggcggggggctcggggggcagaggccgcttccgaggcggcgacggcgtcacccgcg

 1.26 Intr +  13112  13221  110  2  2  -61   74   264 0.531  11.19
acacgcatcaccgaccctgagatcctggagagccggtgagcggcgtgcgcggaggctggg
ggcacggccgggtgggagccggggctcgggccacgctgagtctttgccctcgtcctcgcc
ctcgcaggtacccggtcatcctgcgccgcttcgagctgcggcggggggctcggggggcag
AGGCCGCTTCCGAGGCGGCGACGGCGTCACCCGCGAGCTGCTCTTTCGTGAGGAGGCGCT
GCTGTCAGTGCTGACCGAGCGCCGCGCCTTCCGGCCATACGGGCTCCACG
gtgcgcggttccccagccctcgcggccctccccgcccccgcccccacccccgcccctggt
ctctctggactcctcgcctccctccgcagggggcgagcctggcgcccgcggcctaaacct
gctgatccgcaaaaacggccggacggtgaatctgggcggcaagacgtcggtgaccgtgta

 1.27 Intr +  13311  13408   98  1  2  114   74   190 0.999  21.09
gacggcgtcacccgcgagctgctctttcgtgaggaggcgctgctgtcagtgctgaccgag
cgccgcgccttccggccatacgggctccacggtgcgcggttccccagccctcgcggccct
ccccgcccccgcccccacccccgcccctggtctctctggactcctcgcctccctccgcag
GGGGCGAGCCTGGCGCCCGCGGCCTAAACCTGCTGATCCGCAAAAACGGCCGGACGGTGA
ATCTGGGCGGCAAGACGTCGGTGACCGTGTACCCCGGG
gtaagggccgcggcctgtcctgtccccctcccctcccctcccctcccggccccatcccac
agagggggaacagttgcagacctgaccagaggccgagtttaatttggccccggaaggaaa
gggggcgcgtaccgggcctccgtggtccatgggggcgggtgatggacgctgcccggtggg

 1.28 Term +  13665  13811  147  2  0   94   55   186 0.999  14.75
cagacctgaccagaggccgagtttaatttggccccggaaggaaagggggcgcgtaccggg
cctccgtggtccatgggggcgggtgatggacgctgcccggtggggaggggactgcgcagg
tgacagggaggggccacgcctgcactgagcccgcctccccgcccccccccgcgccaacag
GATGTGTTCTGTCTCCACACGCCCGGCGGCGGTGGCTATGGGGACCCGGAGGACCCCGCC
CCACCGCCGGGGTCGCCCCCGCAAGCACTGGCCTTTCCCGAGCACGGCAGCGTCTATGAG
TATCGCCGGGCCCAGGAGGCCGTGTGA
ggatcccgcaataaagatgccttaagtctcccggttctggggacgcagctacggcgccta
gttcgtgctccgagtcgtgtctgtgcgcgccagccgcgcgcccctcatctgtgcttgcct
taggaggacactgagactcggagctgcaggcgcactgcccggtggtccgtgagcccctcc

 2.05 PlyA -  13838  13833    6                              -6.56
 2.04 Term -  14195  13931  265  1  1   93   48   296 0.989  22.09
 2.03 Intr -  14342  14279   64  0  1   86  101    54 0.994   5.42
 2.02 Intr -  14598  14509   90  1  0  116    9   118 0.989   7.82
 2.01 Intr -  14834  14679  156  0  0   87   37   259 0.969  21.87

Predicted peptide sequence(s):


>OPLAH_1|GENSCAN_predicted_peptide_1|1400_aa
GLLSLAGLLAPASCRRWLPGMSLLSSYEGLRQEIQRLAQENEELRRLVQLIQENQELKLV
LRNRGSSLGFCSSGFLAEVAASPWLPRRRTIKFKNAERGTPRMRRAGEPLVPLAGLPAEE
LLWDSSPTTMGSPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYADAPTEGI
RRILEQEAGMLLPRDQPLDSSHIASIRMGTTVATNALLERKGERVALLVTRGFRDLLHIG
TQARGDLFDLAVPMPEVLYEEVLEVDERVVLHRGEAGTGTPVKGRTGDLLEVQQPVDLGA
LRGKLEGLLSRGIRSLAVVLMHSYTWAQHEQQVGVLARELGFTHVSLSSEAMPMVRIVPR
GHTACADAYLTPAIQRYVQGFCRGFQGQLKDVQVLFMRSDGGLAPMDTFSGSSAVLSGPA
GGVVGYSATTYQQEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINT
VAAGGGSRLFFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFG
PGENQPLSPEASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRA
LTQARGHDPSAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEA
QEPCSLLYAPETFVQLDQRLSRLEEQCVDALQAQGFPRSQISTESFLHLRYQGTDCALMV
SAHQHPATARSPRAGDFGAAFVERYMREFGFVIPERPVVVDDVRVRGTGRSGLRLEDAPK
AQTGPPRVDKMTQCYFEGGYQETPVYLLAELGYGHKLHGPCLIIDSNSTILVEPGCQAEV
TKTGDICISVGAEVPGTVGPQLDPIQLSIFSHRFMSIAEQMGRILQRTAISTNIKERLDF
SCALFGPDGGLVSNAPHIPVHLGAMQETVQFQIQHLGADLHPGDVLLSNHPSAGGSHLPD
LTVITPVFWPGQTRPVFYVASRGHHADIGGITPGSMPPHSTMLQQEGAVFLSFKLVQGGV
FQEEAVTEALRAPGKVPNCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQA
YMGHIQANAELAVRDMLRAFGTSRQARGLPLEVSSEDHMDDGSPIRLRVQISLSQGSAVF
DFSGTGPEVFGNLNAPRAVTLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPRGSILDPSP
EAAVVGGNVLTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPSWH
GRSGVHSHMTNTRITDPEILESRGRFRGGDGVTRELLFREEALLSVLTERRAFRPYGLHG
GEPGARGLNLLIRKNGRTVNLGGKTSVTVYPGDVFCLHTPGGGGYGDPEDPAPPPGSPPQ
ALAFPEHGSVYEYRRAQEAV

>OPLAH_1|GENSCAN_predicted_peptide_2|191_aa
XDGPLRSKQLTPLLDWAEKFGAEKFEADREQSGEVVAFSVLLGDLNFDNCWKDHRLEQEH
ELFRCFQDPCRLGTRQKQPWALGTALSTSVLHQSMASSPKMPRRALEQEKGRHLYLAGLP
GRSRRAKPWRGRRLDYITYRGVPGWLGLRHWDDPQPDSRPQEVEQVTFSTALEGLTDHRA
VRLQLRVSVSS