GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:35:14

Sequence NPM2_1 : 15162 bp : 49.53% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1791   1905  115  0  1  110  -13    95 0.253   2.05
ttccctcggccccacccagaccgacgccaagggcagctgtggagtggggcgcggcaatgc
gccccttaacagccctccaggtgattctgccgcgcagaggaggaaagaatgggagaaggg
aaggggagagggaggcggcttctttgcgactaattggacacctgcccttccccttcccag
GCTTCTTAGCCCGGGCTTGGACAGCCGCCTTCCGGCCAGAGGGGATGAGGTTGCGCTGCG
CTCCGGGAGCGCCGATGGCGTGACTGGCCCCGCGCGGAGCAGCGACAGTAAGGCT
gtgtggggggagctgggacctaagccgcgcgcacacccctttctctgcgtctggtggagg
tgcacagaggcttttgagtcaggcccaagcgcagccaggtgacctccccgcggcctttca
agcctgagctcggtggacagctccctctcccgtgagtcccgctgtcctgtacgcgcccgg

 1.02 Intr +   2166   2373  208  2  1   46   84   131 0.288   7.15
aggcccaagcgcagccaggtgacctccccgcggcctttcaagcctgagctcggtggacag
ctccctctcccgtgagtcccgctgtcctgtacgcgcccggtcgagccccgggctgcgcac
cccgctaggaggtgggtactcgtcctccaggagttgccggtgagcccttgaccgtggcag
GTCCCCTCCAGCCGCGAGCGACCCCTCAGTACCTGCCGATGCCTGCTGGTCTCTGGCATC
CTCCAGTCGAGGGTCAGGGTCAGGGAGCAAGGCCTCACGCGGGCGCCCTCCTTGCAGCTG
CCCGGCCAGCCCGCTTCTCTGCCCGGAGCCATGAATCTCAGTAGCGCCAGTAGCACGGAG
GAAAAGGCAGTGACGACCGTGCTCTGGG
gtgagtggggactcaggctccttcccagagacacgccccacctccggtgcgcggcagctt
ggggcgcaggtgagcccctcctttgggaacgaatggagggccccacttccctccctttct
cctccgcaggctgcgagctcagtcaggagaggcggacttggaccttcagaccccagctgg

 1.03 Intr +   2503   2588   86  2  2  139   90    -3 0.996   4.54
tcagtagcgccagtagcacggaggaaaaggcagtgacgaccgtgctctggggtgagtggg
gactcaggctccttcccagagacacgccccacctccggtgcgcggcagcttggggcgcag
gtgagcccctcctttgggaacgaatggagggccccacttccctccctttctcctccgcag
GCTGCGAGCTCAGTCAGGAGAGGCGGACTTGGACCTTCAGACCCCAGCTGGAGGGGAAGC
AGAGCTGCAGGCTGTTGCTTCATACG
gtaggtgttcccaaaagaggggaggaagatggtgtccgggaactttctggtcccaacgga
gggctatggatttctcccgtcggccctcagggtgatgaggggcctctattttcaaccccg
ctcagatttgcttgggggagaaagccaaagaggagatgcatcgcgtggagatcctgcccc

 1.04 Intr +   2714   2839  126  1  0   54   62   147 0.989   9.58
gaccttcagaccccagctggaggggaagcagagctgcaggctgttgcttcatacggtagg
tgttcccaaaagaggggaggaagatggtgtccgggaactttctggtcccaacggagggct
atggatttctcccgtcggccctcagggtgatgaggggcctctattttcaaccccgctcag
ATTTGCTTGGGGGAGAAAGCCAAAGAGGAGATGCATCGCGTGGAGATCCTGCCCCCAGCA
AACCAGGAGGACAAGAAGATGCAGCCGGTCACCATTGCCTCACTCCAGGCCTCAGTCCTC
CCCATG
gtgcgcatttccctgctggctggaagactgctgtcagcctcaccctcacccttgggtggg
gatggacacacacgagggtgcattcaccctacagaaatgagccatgctagggaggtagca
cagcccatgcagaaagccggggtccagcccagctcaccccttcctagagctgtgtgacct

 1.05 Intr +  10197  10290   94  2  1  142  115    13 0.903   8.94
gtgagcttagcaagaatgggattaccaggttcaaattcttggacagaatccacctcagca
ggggctgagtagtgtgtagggtttggggagggaaatcaactcagtatttctgcctgaggc
tagtccccgagaggtgccaggcctaagtggccctgtcttctctgcttcctccccctgcag
GTCTCCATGGTAGGAGTGCAGCTTTCTCCCCCAGTTACTTTCCAGCTCCGGGCTGGCTCA
GGACCCGTGTTCCTCAGTGGCCAGGAACGTTATG
gtaagtcagagcctgcgatcaggaaggtccgtgagtaccgtgctaggcaggggctcggga
catactagctactcaaacactggagggattcttgaatgttggaagaaaatccccaaaggc
aacatgacagccagcagcctggactggaaggcaagggcgctggtccctgttcttcttctt

 1.06 Intr +  11176  11342  167  2  2   71   81   261 0.970  23.38
gttgggagggccagaaagggtgccgccctgtacaggtggcaggcaggtaaccactgtcaa
ctccaggctaggattcctccagggcagtgcttggagcaacacggatcacagaatgggagg
tgggcattgattctgtagctctgaagctgtgcccctgcatcctttcccatgctattacag
AAGCATCAGACCTAACCTGGGAGGAGGAGGAGGAAGAAGAAGGGGAGGAGGAGGAAGAGG
AAGAGGAAGATGATGAGGATGAGGATGCAGATATATCTCTGGAGGAGCAAAGCCCTGTCA
AACAAGTCAAAAGGCTGGTGCCCCAGAAGCAGGCGAGCGTGGCTAAG
gtgggggaaggagcgtggctgtttggaaggaagtggtacccctacagaagcacttaagag
gggtgggccaccgggagcctgggccagcctcccagaatgagtgtacaggatgggccaagg
ccacctcagctagttctggccaggagctcagcggggaccttgtggactttgggaatctgt

 1.07 Intr +  11577  11611   35  2  2  105   88    43 0.949   3.02
taagaggggtgggccaccgggagcctgggccagcctcccagaatgagtgtacaggatggg
ccaaggccacctcagctagttctggccaggagctcagcggggaccttgtggactttggga
atctgttctggctctggactttgtctgaactctcataatacactgttttttggttcccag
AAAAAAAAGCTGGAAAAAGAAGAAGAGGAAATAAG
gtaactctttctacctattaaattagccaaagtctccagctgagatatacagtgttagaa
agaatactgtgctgttgggatgtacgtgtacaaatgtacacacggtgtgtctacctgcac
tcgcaggcacatgggtatggaagtgctgaagggtggcatcacctttctggaagagcatta

 1.08 Intr +  13560  13593   34  0  1   95  113    17 0.920   3.13
catatgcgtatgcatgcacacgcacacacatccctttgtttaaagagtccgagtggtccc
caggaggagcagccaggcttgctttccagggtgggcactgggagggccacgccgctggtc
tggagctgagctctctccctgaccccaatcccactcctgctccgctccaccctgttgcag
AGCCAGCGTTAGAGACAAGAGCCCTGTGAAAAAG
gtgagtaggaccagagggctttggcccttgggacaggcgagtattctctggagggggctg
cctggtatggagaagggaacgggaccctggagccctgccttccctccacaggccaaagcc
acagccagagccaagaagccaggattcaagaaatgaggagccacgccttggggggcacgg

 1.09 Term +  13705  13749   45  0  0   87   55    40 0.795  -2.19
caatcccactcctgctccgctccaccctgttgcagagccagcgttagagacaagagccct
gtgaaaaaggtgagtaggaccagagggctttggcccttgggacaggcgagtattctctgg
agggggctgcctggtatggagaagggaacgggaccctggagccctgccttccctccacag
GCCAAAGCCACAGCCAGAGCCAAGAAGCCAGGATTCAAGAAATGA
ggagccacgccttggggggcacggtgcaaagtgggccttccctgggctgtgctgcaggca
cagggtgcccctgtccagcccctccacctgtgtctgaatgcaacaggggtgttgcggggg
caacatgagagcccctcacccccaactctccactttcaggaggcccccagtgaagagccc

Predicted peptide sequence(s):


>NPM2_1|GENSCAN_predicted_peptide_1|303_aa
XLLSPGLDSRLPARGDEVALRSGSADGVTGPARSSDSKAVPSSRERPLSTCRCLLVSGIL
QSRVRVREQGLTRAPSLQLPGQPASLPGAMNLSSASSTEEKAVTTVLWGCELSQERRTWT
FRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMV
SMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDA
DISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPG
FKK