GENSCAN 1.0	Date run: 17-Jan-104	Time: 01:04:27

Sequence NAT2_1 : 12327 bp : 37.01% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   2674   2766   93  0  0   49   99    52 0.243   2.83
cagctgattagatggtgcccacccggattgagggtgggcctccctttctcagtccactga
ttcaaatgttaatttcctttggcaacaccctcacagacacacccaggaacaatactttga
atccttcaatccaatcaagttgacactcaatattaaccaccacacttgggaaacttgaga
ATGAAGACCCAACTTCCCAGTAAGTTACAGAAACTCATGTATTATTCCGAGGCCACAGTA
AAGAGTGGAGACTCAAAGCATGGCCAGAAACAG
gtaaattagttttagtggcaacacaggttaagagagagaggaaggaagaagctcggctag
caaaggtggccttgttatgtagacgaaccttttctcagaagcaaaagatggtaaatgttt
ctatccagatctttaaaggtgtcagactctcaatcgctctggatcctgggaaaggcttag

 1.02 Intr +   5929   5940   12  0  0  114  121     5 0.240   0.46
attgtaaataagtcattcatttaggcaaagtgataactcaaagatttcaaaaagtaaaaa
ccttcactctttgagagagaggactcactttcacaaacaataagacctaataaagacagc
atgaggccaactaaatttgtctctcttccccaacccatctttttttttttttttttgcag
TTTTCTCAAAAG
gtaagcaaaaatctttcactatctcttaatattaaaagaaaatcttattcaaaggaaatc
taaattttaccattgcatagcttattattaatgctaaagttagcattaataaaatcttac
aaacaaatctatttaattagttgtaacacaaggtagagatttttataaatcttttacaac

 1.03 Intr +   8259   8285   27  2  0   77  115    19 0.269   0.89
aacacacaggggaaattgtcctttttatgcttaggtgcgacaaggtatgggcacatataa
aaatatgattgaggcaaaaggcataacctaatgccaatggactggggaaacccagcaaga
cctgtctgtctagattcctcttgacctctctgagcatgtactccttccttctgggtatag
GGATCTTATGACCTACAATCCAACAAG
gtaagttggataatttctttatggctaattcatacacagaaagggagagggcaaattaga
gtaatatttttagactttgtggctggttttgagaaaaaggagttctgatttctaggttct
gccttggggaaagagattctagtttgtttggccagctttgagggatattgggactgagag

 1.04 Term +   9954  10832  879  2  0   79   39   506 0.415  36.35
gaacttatgcatgtaaaagggattcatgcagtagaaatactaacaaaagaattactatga
cagatacttataaccattgtgtttttacgtatttaaaatacgttatacctataattagtc
acacgaggaaatcaaatgctaaagtatgatatgtttttatgttttgtttttcttgcttag
GGGATCATGGACATTGAAGCATATTTTGAAAGAATTGGCTATAAGAACTCTAGGAACAAA
TTGGACTTGGAAACATTAACTGACATTCTTGAGCACCAGATCCGGGCTGTTCCCTTTGAG
AACCTTAACATGCATTGTGGGCAAGCCATGGAGTTGGGCTTAGAGGCTATTTTTGATCAC
ATTGTAAGAAGAAACCGGGGTGGGTGGTGTCTCCAGGTCAATCAACTTCTGTACTGGGCT
CTGACCACAATCGGTTTTCAGACCACAATGTTAGGAGGGTATTTTTACATCCCTCCAGTT
AACAAATACAGCACTGGCATGGTTCACCTTCTCCTGCAGGTGACCATTGACGGCAGGAAT
TACATTGTCGATGCTGGGTCTGGAAGCTCCTCCCAGATGTGGCAGCCTCTAGAATTAATT
TCTGGGAAGGATCAGCCTCAGGTGCCTTGCATTTTCTGCTTGACAGAAGAGAGAGGAATC
TGGTACCTGGACCAAATCAGGAGAGAGCAGTATATTACAAACAAAGAATTTCTTAATTCT
CATCTCCTGCCAAAGAAGAAACACCAAAAAATATACTTATTTACGCTTGAACCTCGAACA
ATTGAAGATTTTGAGTCTATGAATACATACCTGCAGACGTCTCCAACATCTTCATTTATA
ACCACATCATTTTGTTCCTTGCAGACCCCAGAAGGGGTTTACTGTTTGGTGGGCTTCATC
CTCACCTATAGAAAATTCAATTATAAAGACAATACAGATCTGGTCGAGTTTAAAACTCTC
ACTGAGGAAGAGGTTGAAGAAGTGCTGAGAAATATATTTAAGATTTCCTTGGGGAGAAAT
CTCGTGCCCAAACCTGGTGATGGATCCCTTACTATTTAG
aataaggaacaaaataaacccttgtgtatgtatcacccaactcactaattatcaacttat
gtgctatcagatatcctctctaccctcacgttattttgaagaaaatcctaaacatcaaat
actttcatccataaaaatgtcagcatttattaaaaaacaataactttttaaagaaacata

Predicted peptide sequence(s):


>NAT2_1|GENSCAN_predicted_peptide_1|336_aa
MKTQLPSKLQKLMYYSEATVKSGDSKHGQKQFSQKGSYDLQSNKGIMDIEAYFERIGYKN
SRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQL
LYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQP
LELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTL
EPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVE
FKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI