GENSCAN 1.0	Date run: 17-Jan-104	Time: 01:12:12

Sequence MTMR9_1 : 45730 bp : 38.03% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1283   1464  182  1  2   95  101   168 0.451  17.56
ggtgccggcggctgtaggcctcgccgcgcccacccagcctggggcgggcccagcctcacc
gcccggcccgccccgccccacgggccagccccgcgccgggtgtttccgctacttccctgc
ggcggggtaaccgcctcgcacctaccgggctcggttccctggctccggccgcgggggagc
ATGGAGTTTGCGGAGCTGATTAAGACCCCGCGGGTGGACAATGTGGTGCTGCACCGGCCT
TTCTACCCGGCTGTCGAGGGCACCCTGTGCCTGACGGGCCACCACTTGATCCTGTCCTCC
CGGCAGGACAATACGGAGGAGCTGTGGCTCCTCCATTCAAACATCGACGCCATCGACAAG
CG
gtgagtgcccgccccaccccagctccgcagggagccgggggtcccttgtgggcgccccgg
gaaatacttcctggcgttttccgcgcagcctgccgcccagctagccggcaagatgagccc
tctgtggcctagaatcaggatttaccaagctgaaacccgtccagatggaggacccggttt

 1.02 Intr +  11588  11696  109  2  1   65  107   104 0.819   9.37
ttgtaagtaatgtatggctcacattttaatgatgcagccttgcttcttccttaattagac
tgaggagaagaaagttaatatagatggtaactacaactatattctcttttcaaagaaata
ataatatatttaaagttagtaatatatgtgttcctaaacatgatttgcaatttcttacag
ATTTGTAGGATCACTGGGTACCATCATCATAAAATGTAAAGATTTTCGAATTATTCAGTT
GGATATTCCTGGAATGGAGGAATGCTTGAATATAGCCAGTTCCATTGAG
gtaagtattttggaagcaaaatctaatgaaacataattttatattatgactcagtgtagc
tcttccatttcttcattagataatttagtcatgttctctgactcaaatactgaagactga
taggaaaagcctcaccctggttcatcgtcatatgagtgtaatggaactttcttgacttcc

 1.03 Intr +  16417  16542  126  0  0  108   68    86 0.994   8.56
aagcaaagaaatcagcttcagtaagactaaaattgtatctggtgataaacacaatgttag
agaaacattctgggtgcccatcattattagaccatgtttgcttaatactaatttgtcagt
tagaatatgtttccagttgtggatgtttcttttttgtctttcttttctttttgcccccag
GCATTGTCTACTCTGGACTCCATCACTCTGATGTACCCTTTCTTTTACCGTCCTATGTTT
GAAGTGATAGAAGATGGCTGGCATTCCTTCCTTCCTGAGCAAGAATTTGAACTCTATTCT
TCAGCT
gtgagttaacttttgagaactgtggattatgagaagtaacccaataccttatttgacttg
tgaaaatgatcacttcttttgaagagtaataaggtgaagttgacttatccattcctaatc
ttaatatatttaaaaggattgaagccatgcagagtatgatctctgatcacaaaggaatta

 1.04 Intr +  21235  21408  174  0  0   74  115   153 0.993  15.81
aaccatagagctccttttctctgcagctacttacatataagctagagatccacctgtgaa
attcctgagaaatggcttcttcatcagtgaaagttgacctctaaggtcttttaaaatttc
tcagattattttgcgacattgagatagttgcttagctttgaagtattttgtgtttttcag
ACCAGTGAATGGAGGCTAAGCTATGTCAATAAGGAATTTGCTGTCTGTCCCTCTTACCCA
CCAATTGTCACAGTGCCCAAATCCATCGATGATGAAGCTCTTCGGAAGGTAGCTACATTT
CGACATGGAGGGCGCTTCCCAGTACTAAGCTATTACCACAAAAAAAATGGGATG
gtaagtgcacagcactactgcttgatgtactgaaaggcttgggttggggatcttttcgta
gaaatgttcccttttgctctctgtctgttcactgaaatgattgtccaggtctccaccaca
agggcttccttcatgtaagctttagggaatcaggagtagggtgttttctgtggtgaggat

 1.05 Intr +  22584  22801  218  2  2   78   83   284 0.999  23.28
tcttttatagttattaactattgtcaatacatgcaaatatttctttgtttatggatcaaa
tccatctgcagagtgtcacacaattgtttttgagatactcttaatctagctaatttcttt
ctgttttcagaaactttaaaagcaactgctgttgaattttcagctttattatgcttctag
GTAATTATGCGAAGTGGTCAGCCACTCACTGGTACAAACGGGAGGAGGTGCAAGGAGGAC
GAGAAGCTGATAAATGCTACCCTCAGGGCTGGAAAGCGTGGCTACATCATTGACACCCGA
TCCCTGAACGTGGCTCAGCAAACTAGAGCCAAAGGAGGTGGCTTTGAACAAGAAGCTCAT
TATCCTCAGTGGAGGCGAATTCATAAGTCCATTGAGAG
gtaaaagattccaaagatagtacagactcttattagaagctaattatagtgggtaaggcc
ttagccatttgaaaatcacaagtgctcaaattaacttctgcattaatttagggtcaatga
tgggctagccatcttctcatttttttttggtcagctctattaaggtttgattgacaaata

 1.06 Intr +  25921  26082  162  1  0   65  103   154 0.999  12.77
caacaatgtttaaatattagtttttcaacctttaatcctcaaattatagcagggtaaata
tttttatagtattttgaactacttttgctcttagatatgttggaggctgaatctttggtt
tggtttctttatctttctattttctgggtttgttattttttactttcttacttttaaaag
GTATCACATTCTTCAGGAGAGCTTAATCAAACTTGTGGAAGCTTGTAATGACCAAACACA
TAACATGGACCGATGGCTCAGTAAATTGGAGGCCTCTAACTGGCTGACTCACATCAAAGA
GATTCTGACAACTGCCTGCCTAGCGGCTCAGTGCATCGACAG
gtaaagtgcatttcagcgttcctgagcgaaacatggcgctgctaactagactttgtgttt
atccagacatatgtttatagattatgtgaaagtttgcagtaaattactgtgtaggctagt
caacaccatcccattattgatgaggtgtgtgcctagagtctggcatttaatagataatgt

 1.07 Intr +  31317  31458  142  0  1   89   94   116 0.999  11.73
cttagatttagatttagattctgaactctacaagtcagagcagaatgttgtactcaatac
actaaataaactgaactcagtagactaaaatgttgtgctcaataaacgcttgttattaac
agagttcattgaccatgttggacatttcccatttgtactcttccctgattttcctatcag
GGAAGGAGCATCAATATTGATTCACGGAACAGAAGGAACTGATTCCACACTCCAGGTGAC
CTCCTTGGCCCAGATCATCTTAGAGCCAAGAAGCAGGACCATTCGTGGTTTTGAGGCCCT
GATTGAAAGAGAGTGGCTGCAG
gtgagaagagctgtttgattcacagaggaactgcttattgatgctgtgatcctgctttgt
gtggtagctgacataatgtgtgaaatttcgattgattaaaatttctaagttgtgtgttta
atttactgcaggacagttaatctgtcttctccttgtttctggatgtctctttgcctgtat

 1.08 Intr +  33067  33287  221  0  2  126  113   124 0.998  14.88
tagttgctgccgctatttattttataccaagaaatcattaatctgtacaacagctaccct
aattatatgatgttccaggtactaggagtgtcactgtaattgtgtatagtggtgtcggta
gaatgctctgtcatgtgatctcaccaggatatgactgtcacgcctccatcttccccctag
GCTGGTCACCCATTCCAGCAGCGCTGTGCACAGTCAGCCTACTGTAACACCAAGCAGAAG
TGGGAGGCTCCTGTATTTCTTCTCTTCTTGGACTGCGTGTGGCAGATCCTTCGTCAGTTT
CCCTGTTCTTTTGAGTTTAATGAGAATTTCCTCATCATGCTCTTTGAGCATGCTTATGCC
TCACAGTTTGGAACATTTCTGGGCAACAATGAAAGTGAAAG
gtgagtacactgctcacatggggacctttccttttccgttgttttggctacttcctaagt
agccagaatctcctaggagacgacgatttggatctatattaaaattatttataaaaaggt
agaggctacagttaattataatttaaatgacctgaagtatattcttttatgagagcatgt

 1.09 Intr +  36081  36232  152  0  2   66   92    93 0.927   6.39
gttctaatgccgattgagctttttgacaaatctattgatttttcaacactttgtttctct
accaaaagtcttgtattctatcttctttcatactgagaagaaattgtcctcgtaagagga
gcactcaataatggttgttataaattaattactttaatggcagtgttctttcttgatcag
ATGTAAGTTGAAGCTACAGCAGAAGACGATGTCTTTGTGGTCCTGGGTTAATCAGCCCAG
TGAGCTGAGTAAATTCACCAATCCCCTCTTTGAAGCCAACAACCTTGTCATCTGGCCTTC
AGTTGCTCCGCAGAGTCTTCCACTGTGGGAAG
gtaaaccacgcatcctttgcaaacttcttaacggtcaggtgtgcatgcggctgcctgtga
gtgtgtgctgttggtgatgtatgaagatggtgagctggacgtggccctcagacctgtgtg
aattgtcattctcagtgtgggcatgtttttctctttcaaatcagttatctagccacactt

 1.10 Term +  39019  39182  164  2  2   61   48   194 0.998   9.82
atccttttcagtacctcaagattcctgtatattttagagtataataaaatacagatgtga
gttgtggcaacaaaagaaaaaagaatgtataatacataaattacatcttatccacaaatg
taattttaatccattgtatatacctttcttgcttctgttttccattcctggattcaatag
GTATTTTCCTACGTTGGAATAGATCCTCTAAGTATTTGGATGAAGCATATGAAGAAATGG
TTAACATCATTGAATATAATAAAGAATTACAAGCAAAAGTCAATATCCTTCGAAGGCAGT
TGGCAGAACTGGAAACAGAGGACGGGATGCAGGAGAGTCCCTGA
aaggtctcctcgcacccttcgcaaggaccttcttgggcctgtgtccgccgttctctcctt
gtgcccttcagttcacttttacacggtagccttgaagtgaaggctttagatgtgggaccc
ccctaatgtaatggatttctcaatactgtatgaataatgaaacttactatcataaaccat

Predicted peptide sequence(s):


>MTMR9_1|GENSCAN_predicted_peptide_1|549_aa
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNL
VIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELE
TEDGMQESP