GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:50:57

Sequence LY6H_1 : 4767 bp : 66.60% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1852   1903   52  0  1  103  117   222 0.764  26.00
ctccgggcggaccccggccttggattccggggagaaggttgcatcctgaggctgggaaag
gagagggtctttggggtctcctgaccgatgcttctcccctccaggcttgcgccccagagg
acccgcgccccaagcccccgcgccgcccccaggcccacccggagcatgctgcctgcagcc
ATGAAGGGCCTCGGCCTGGCGCTGCTGGCCGTCCTGCTGTGCTCGGCGCCCG
gtgagtagggggcccgcgggctgggtcaggtgcctgggagagcccgaggcgccgcgggag
agccgggtgtggggctgccaccctctgacggttcccaccgcacttcgcatagagcccacg
ccccctccgggacccctgcgaccccagcccggccctcggcccctctgccccggcactggg

 1.02 Intr +   2094   2279  186  1  0   78   50    57 0.408   1.77
ggcccgcgggctgggtcaggtgcctgggagagcccgaggcgccgcgggagagccgggtgt
ggggctgccaccctctgacggttcccaccgcacttcgcatagagcccacgccccctccgg
gacccctgcgaccccagcccggccctcggcccctctgccccggcactgggctctctccag
CGCTCTTCCTCCAGGGCCTGGAACTGGTGGGCGGCTGGCCCCGCACGGAAGCCCTTGGTC
ATCCGTCACCTCTGAGAGCCTCCCGGGCCTCCTTTCAAATCCAGTTTGGTCCTTCACAGC
TTGGAACCCACGGACCTCTGGGGGGGATATGTGAGGCGGGGCGGGAGTGTGAGGGGGGCA
CTGTCG
gtgtggggtctgtatagcccgtgtgtgtgtttgtgtgtgtgtgtgcacgcacgtgcatgg
gggccagggaggggccataggggctcccctcaaactgccaggatggggcacagttgtccc
agggcctctgctccccctccaggggtcatgggggcctgctccctcccgtggggtcgggct

 1.03 Intr +   2563   2682  120  2  0   82   92   114 0.983  12.84
tggggcacagttgtcccagggcctctgctccccctccaggggtcatgggggcctgctccc
tcccgtggggtcgggctctcccaggagtgcctgcagcagggggatgggtggggggcgcag
ggggctgcctggtttggaccccagtgcctctggtcaccctcctccccatgccctgcccag
CTCATGGCCTGTGGTGCCAGGACTGCACCCTGACCACCAACTCCAGCCATTGCACCCCAA
AGCAGTGCCAGCCGTCCGACACGGTGTGTGCCAGTGTCCGAATCACCGATCCCAGCAGCA

gtaagttgggacttagggtggtggggaatgtgctaaaagccaggctcttgagagaggtca
gaggtgtcctcggagcccctctggcctgggacgagagtgagagcgtggggcggcaggcag
gatactgtcctgctgtccccccctggctccttggtggcccttttcatctagttgaggcca

Predicted peptide sequence(s):


>LY6H_1|GENSCAN_predicted_peptide_1|120_aa
MKGLGLALLAVLLCSAPALFLQGLELVGGWPRTEALGHPSPLRASRASFQIQFGPSQLGT
HGPLGGICEAGRECEGGTVAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSX