GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:41:21

Sequence LOXL2_1 : 109334 bp : 48.95% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.04 PlyA -    703    698    6                               1.05
 1.03 Term -   6205   6060  146  2  2   93   48    88 0.989   3.37
 1.02 Intr -   6485   6323  163  2  1   57   94    81 0.807   5.15
 1.01 Init -  12198  12040  159  0  0   52   63   141 0.405   7.84
 1.00 Prom -  12517  12478   40                              -6.46

 2.01 Init +  26543  26969  427  1  1   81   77   284 0.393  23.07
tggacagagaatgactgacaagttgagagaagaaggcttcagacgatcaaactactccaa
gctaaaggaggaatttcaaacccaacataagctaaaaaccttgaaaaaagattagatgaa
tggctaactagaataaccagtgtagagaagtccttaaatgacctgatggagctgaaaacc
ATGGCACGAGAACTACGTGACGAATGCACAAGCTTCAGTAGCCGTTTCGATCAACCAGAA
GAAAGGGTATCAGTGATTGAAGATCAAATGAATGAAATGAAGCGAGAAGAGAAGTTTAGA
GAAAAAAGAGTAAAAAGAAACGAACAAAGCCTCCAAGAAATATGGGACTATGTGAAAAGA
CCAAAGCTACATCTGATTGGTGTACCTGAAAGTGACGGGGAGAATGGAACCAAGTTGGAA
AACACTCTGCAGGATATTATCCAGGAGAACTTCCCCAACCTAGCAGGGCAGGCCAACGTT
CAAATTCGGGAAATACAGAGAATGCCACAAAGATACTCCTGGAGAAGAGCAACTCCAAGA
CACATAATTGTCAGATTCACCAAAGTTGAAATGAAGGAAAAAATGTTAAGGACAGCCAGA
GAGAAAG
gtcaggttacccacaaaaggaaacccatcagactagcagcagatctctcagcagaaactc
tacaaaccagaagagagtgggggccaatattcaacattcttaaagaaaagaattttcaac
ccagaatttcatatccagccaaactaagcttcataagtgaaggagaaataaaatccttta

 2.02 Term +  27923  28986 1064  0  2   28   46   331 0.468  15.20
ttagactcccacacaataataatgggagactttaacaccccactgtcaacattagacaga
tcagtgagacagaaagttaacaaggatatccaggattgaactcagctctgcaccaagcgg
acctaatagacatctacagaactctccatcccaaatcaacagaatatacattcttctcag
CACCACATCGCACTTATTCCAAAATTGACCACATAGTTGGAAGTAAAGCACTCCTCAGTG
AATGTGAAAGAACAGAAATTATAACAAACTGTCTCTCAGACCACAGTGCAATCAAACTAG
AACTCAGGATTAAGAAACCCACTCAAAACTGCTCAACTACATGGAAACTGAACAACCTGC
TCCTGAATGACTACTGGGTACATAACAAAATGAAGGCAGAAATAAAGATGTTCTTTGAAA
CCAATGAGAACAAAGACACAACATACCAGAATCTCTGGTACACATTTAAAGCAGTGTGTA
GAGGGAAATTTATAGCACTAAATGCCCACAAGAGAAAGCAGGAAAGATCTAAAATTGACA
CCCTAACATCACAATTAAAAGAACTAGAGAAGCAAGAGGAAACACATTCAAAAGCTAGCA
GAAGGCAAGAAATAACTAAGATCAGAGCAGAACTGAAGGAGATAGAGACACAAAAAACCC
TTCAAAAAATCAATGAATCCAGGAGCTGGTTTTTTGAAAAGATCAACAAAATTGATAGAC
TGCTAGCAAGACTAATAAAGAAGAAAAGAGAGAAGAATCAAACAAATGCAATAAAAAATG
ATAAAGGGGATATCGCCACTGATCCCACAGAAATACAAACAACCATCAGAGAATACTATA
AACACCTCTATGCAAATAAACTAGAAAATCTAGAAGAAATGGATAAATTCCTGGACACAT
ACACTCTCCCAAGACTAAACCAGGAAGAAGTTGAATCCCTGAATAGACCAATAACAGGCT
CTGAAATTGAGGCAATAATTAATAGCCTACCAACCAAAAAAAGGCCAGGACCAGACAGAT
TCGCAGCCGAATTCTACCAGAGGTACAAGGAGGAGCTGGTACCATTCCTTCTGAAACTAT
TCCAATCAATAGAAAAAGAGGGAATCCTCCCTAACTCATTTTATGAGGCCAGCATCATCC
TGATACCAAAGCCTGGCAGAGACACAACAAAAAAAGAGAATTTTAGACCAATATCCCTGA
TGAATATCGATGCAAAAATCCTCAATAAAATACTGACAAACTGA
acccagcagcacatcaaaaagcttatccaccatgatcaagtgggcttcatccctgggatg
caaggctggttcaacatatgcaaatcagtaaacgtaatccagcatctaaacagaaccaaa
gacaaaaaccacatgattatctcaatagaagcagaaaaggcctttgacaaaattcaacag

 3.01 Init +  36967  37321  355  0  1   77   92   624 0.993  57.00
tttccatattaagccaaggggtatgaaatcgctggttctctatgtaggtctccgtagccc
cacgttcccatcctaacgcatctctcctctcttccagaaagctcctgctgcttctgtacc
ccgcctgtccctcccagctgcgcagggccccttcgtgggatcatcagcccgaagacaggg
ATGGAGAGGCCTCTGTGCTCCCACCTCTGCAGCTGCCTGGCTATGCTGGCCCTCCTGTCC
CCCCTGAGCCTGGCACAGTATGACAGCTGGCCCCATTACCCCGAGTACTTCCAGCAACCG
GCTCCTGAGTATCACCAGCCCCAGGCCCCCGCCAACGTGGCCAAGATTCAGCTGCGCCTG
GCTGGGCAGAAGAGGAAGCACAGCGAGGGCCGGGTGGAGGTGTACTATGATGGCCAGTGG
GGCACCGTGTGCGATGACGACTTCTCCATCCACGCTGCCCACGTCGTCTGCCGGGAGCTG
GGCTACGTGGAGGCCAAGTCCTGGACTGCCAGCTCCTCCTACGGCAAGGGAGAAG
gtaaacgctctgtgctttggatctgagtgctgtcacctggcaaggcccggagtggccttc
cctgaggtcagcctgggagaggaggctgcacgcactgcgaagtgtaaattcttggtgatg
cccatccagggactggcatccttctgtgcccactcaggctgcaccctgcaggaaggcggg

 3.02 Intr +  45053  45232  180  0  0  111  -16   192 0.275  10.94
tccaggaatccccatggtttagagttatgtgcaatatcttaatataataaaaatggatgg
ccacacacagctgccaaaattagagaaaaattctctttccatgtgagacactggtgcccc
gcaaagactcagacctgcattgacgcagcacttggtttctctcctctctgcctccttcag
GGCCCATCTGGTTAGACAATCTCCACTGTACTGGCAACGAGGCGACCCTTGCAGCATGCA
CCTCCAATGGCTGGGGCGTCACTGACTGCAAGCACACGGAGGATGTCGGTGTGGTGTGCA
GCGACAAAAGGATTCCTGGGTTCAAATTTGACAATTCGTTGATCAACCAGATAGAGGCAA

gtcatgtgctcttgatgtttccttcatgcaaacatttttcctcttccatgcaactcgctt
tttgcgtattgatttcaagaagtgtgtgtgagcaggaaggagggtacctcacccaatggg
attagatacaagggcagtttagggaaggatttctggagaagggaatcccatccatgggga

 3.03 Intr +  61051  61166  116  2  2  102   62   127 0.449  11.67
cagaccatcaagcacacaccaccatgcacacacacagacacagagatacacaccacacac
acacagaccatcaagcacacaccaccatgcacatacacagagatgcataaacacgtatgc
agtgagtcggtggaagaatgaggataatgacccccggtgctagccctttctcttctccag
GCTGCATTGCCTTCATCGTGGAGCCCCCGGGGCTCTCCCCACCAGCCCTATTCAGCGGAG
GAAACTGTCCCGCATCATCGCAGGAACGAGAGCAAGCTCCCTTGGCGTTTGGGTTG
gtgtgtgctggcctcaggcccgcgtagctctttccagcggggtctgctgagctcctccag
ccaggccttcttcctcctcctgtggtggccaggtgctgggggtcacaccttccctgcagc
gagcctgcactgctgcccaacgcaggggaaaggatctgtgaactgaaggtcagcccgggc

 3.04 Intr +  64115  64326  212  1  2  110   71   397 0.499  37.91
ctaactgcagcttgggccgtgtgcccctcggggttgcccagagctcactgcagggcctga
gggcacaggcaggcccgcggcaggcctggcccatagtcgctaaagaagtactggttgcct
ggtgtctctgcagccaggccagtagggtaaccctctccttccacgcctctttcttcccag
AACCTGAATATCCAGGTGGAGGACATTCGGATTCGAGCCATCCTCTCAACCTACCGCAAG
CGCACCCCAGTGATGGAGGGCTACGTGGAGGTGAAGGAGGGCAAGACCTGGAAGCAGATC
TGTGACAAGCACTGGACGGCCAAGAATTCCCGCGTGGTCTGCGGCATGTTTGGCTTCCCT
GGGGAGAGGACATACAATACCAAAGTGTACAA
gtaagaggactgcaccaaaggggtggctttgagggtatccgccctgcctaaaagagttaa
aagtgtccgccctggtggtggcctttccttggccaggcatggccaggcaagctggtgtcc
ctgcaggcagcctgcacagagcccctgggccgggccaggcgccaagttcaagggtgcccc

 3.05 Intr +  71695  71917  223  1  1  111   78   273 0.606  26.73
ggtgcaggcattagcaggtgctcagtgaatgctggcagaatggactgagctgggaccctc
tgtgaagcagggctgagctccaggagcagggcccagtctctcatgttctgcctcgttgca
gaaggaatcggggtaggcgtcatgatgccctggtcccctgtcccctcccatcgtctgcag
AATGTTTGCCTCACGGAGGAAGCAGCGCTACTGGCCATTCTCCATGGACTGCACCGGCAC
AGAGGCCCACATCTCCAGCTGCAAGCTGGGCCCCCAGGTGTCACTGGACCCCATGAAGAA
TGTCACCTGCGAGAATGGGCTACCGGCCGTGGTGAGTTGTGTGCCTGGGCAGGTCTTCAG
CCCTGACGGACCCTCAAGATTCCGGAAAGCGTACAAGCCAGAG
gtgaggacggggcacgaggtgtggccacttggcacctggaggggatgggagggtgttgag
ggagtaggcaggatcccccaggagagtgaggaagggtggcctcagcggagatcaccattg
tggctgctttactctgagacctgagcgccctctgcagagaaggaccacctgggggagaag

 3.06 Intr +  76753  76936  184  0  1   74  116   263 0.982  27.06
cacacacacacacacacacacacacacacacacacatccatacatcaagcatagttgcag
ctcccagactgagtgcctggcctgggaacagggtggcagggaagggagggggcggggaca
gtggtcacccgctgaacgtgcatcagcgtctgtactcagcaggaccgtgtgtctcttcag
CAACCCCTGGTGCGACTGAGAGGCGGTGCCTACATCGGGGAGGGCCGCGTGGAGGTGCTC
AAAAATGGAGAATGGGGGACCGTCTGCGACGACAAGTGGGACCTGGTGTCGGCCAGTGTG
GTCTGCAGAGAGCTGGGCTTTGGGAGTGCCAAAGAGGCAGTCACTGGCTCCCGACTGGGG
CAAG
gtaaggaatggggaggctagagggggcctctcttcctgggagcatggtgccgtgagccca
gcctggctgctggccgtgagctctcgggaaatcctcactttccctcctccctttagtggc
tgcctgggagagaatcccaggcctctccctagacagagttgaaaggggccttagagaaca

 3.07 Intr +  83037  83188  152  1  2   79   59   245 0.757  20.58
agagaattagcactgttctctctggggagaagaggcttgggtcattgagctgattacaag
aggcagtggggagagttctgaggatgggagaggcatgttcttattgtccagggctttctt
gccactccagaaagtttccttccaaagctttcatagagcatgtttattctccccttgcag
GGATCGGACCCATCCACCTCAACGAGATCCAGTGCACAGGCAATGAGAAGTCCATTATAG
ACTGCAAGTTCAATGCCGAGTCTCAGGGCTGCAACCACGAGGAGGATGCTGGTGTGAGAT
GCAACACCCCTGCCATGGGCTTGCAGAAGAAG
gtgatgggactggacacctagaggggactgtaactgaggctgcagaaagtatagccacag
agctctggggtgaaccctggaagtgaccaggtgctgctgctagtactgctgcagacattg
ccacttggcatttgcaatgtttagttccccctcgaacctcgggcctggccctggcccggc

 3.08 Intr +  83936  84028   93  1  0   57  107    38 0.813   2.76
ggctgaccatgaggtcccatacgctccattgtcactggtgaggtcagaccccgctcacca
gaaagccacacggttaccaggatgctgacgctctacgtggggctctgggaatggcaagct
gtgtcctttgctgagttagaactgcatgccagctacactgtgcgctccagtcttctctag
AAAATGAGAAAAGCCCCCCAGTGCATGAAGTGTCCAGATTCCTTCCAGAACAGTCAAACC
CTTCTCTCTGTCCTAGAGGCCATCCCGGGCCTG
gtaagccttaacgccttggagccttggcaggtgcccttggtgaccatgtgttttcctggc
cccagaggcaacgaggcagccacattccgcagccagagcctctgagacttgccttggctt
taggacctagagcaggaacactgctctggctcaggcaagagatgagggagggtagggaag

 3.09 Intr +  85266  85433  168  2  0  108   94   285 0.999  31.24
ctataagaccatgctaggcacagcgctgccaccgggggctcccaagggtgctgctgaatc
tgagtgtgtcccgggcagcaccacctggcttaggactccaggacactggggctgatggca
gcgtaggggggaagctcccttgtccctcttggtgaccgtggcctgcctttgtgtctgcag
CTGCGCCTGAACGGCGGCCGCAATCCCTACGAGGGCCGAGTGGAGGTGCTGGTGGAGAGA
AACGGGTCCCTTGTGTGGGGGATGGTGTGTGGCCAAAACTGGGGCATCGTGGAGGCCATG
GTGGTCTGCCGCCAGCTGGGCCTGGGATTCGCCAGCAACGCCTTCCAG
gtgagaagccccggcctcagaccccgcattcaccccccatgcagtctgaccacactgtct
tcagtcagcccccctctcccacgtaccctccctagccgtgcaggcaggacagagcaagtt
gccctggacccagaggcagggagcctcgctctggccacagcgctgctccttacaggcctg

 3.10 Term +  88204  88461  258  0  0   98   52   188 0.607  11.75
tcccactcactctgccaccaactaactgcacagcttggataggtgaccctccgtgctgtt
tcgatctgaaaaatgggatcatgaaacattgggatttttgtgaggctgcaagttgatagg
atatgagaaagtgacagtttgagatgatgtacccaccatttgttttgttggttcttccag
GAGACCTGGTATTGGCACGGAGATGTCAACAGCAACAAAGTGGTCATGAGTGGAGTGAAG
TGCTCGGGAACGGAGCTGTCCCTGGCGCACTGCCGCCACGACGGGGAGGACGTGGCCTGC
CCCCAGGGCGGAGTGCAGTACGGGGCCGGAGTTGCCTGCTCAGAAAGTGAGAGCTCCTCC
CCTCCCTCCCCACCGGGCTCCCAAGGGGACCAGAGTCCCACCAGTTATTCCTCAAGAGAC
TCTGAAGCCTTGCCATGA
gccaagcaatagaggaaggtagaatgaaatcctaagggagaaaaactgggggcaagagag
atgaccgccaccccaaccacagatcgctgtctatgatgtagtggggagaaaagcgggagg
gaggggctgcagtctgtagcccggattcagtcacaggaccactgctactgcagtgaccca

 4.02 PlyA -  89609  89604    6                               1.05
 4.01 Sngl -  93264  92575  690  0  0   70   48   341 0.972  24.50
 4.00 Prom -  94346  94307   40                              -7.66

 5.01 Init +  95391  95650  260  2  2   78   96   505 0.930  46.91
gtcaaagaggactcacagcagaggaaaagaggaattcagggtcttgctaaacaagaaggt
aaccttgaggagcccttgagtcattccagaaggtggcggtaggcaggagagggggtttgt
cccagctcaagaatcagaagtagaagccctggggaggggtctcttgccttgttgaccagc
ATGCCATCCTCCGCAGCCGCCCCTGACCTGGTCCTCAATGCGGAGATGGTGCAGCAGACC
ACCTACCTGGAGGACCGGCCCATGTTCATGCTGCAGTGTGCCATGGAGGAGAACTGCCTC
TCGGCCTCAGCCGCGCAGACCGACCCCACCACGGGCTACCGCCGGCTCCTGCGCTTCTCC
TCCCAGATCCACAACAATGGCCAGTCCGACTTCCGGCCCAAGAACGGCCGCCACGCGTGG
ATCTGGCACGACTGTCACAG
gtaggcctggctggccaccctccccactaagctgcccggcggacatcctgcaggcctcag
atgggagttgagagttgccagggtcacttagagccaagaggctgcatggcctggggatag
gatcctcctaagtggggggcttgcatctgccacactggctgtcagatttcccgaagccat

 5.02 Intr + 101921 102036  116  2  2  102   55   215 0.993  19.69
tgaagctgcctctgcagcaccggctttcctttcctcaggcctctcatccactcctctccc
cacccggccccctctggtcccctggaagtattcccagaggcaaatcgccagccaggcctc
tgcttgcaagcagcagttgctccagaaactgacctccaggccatctctctctcgctccag
GCACTACCACAGCATGGAGGTGTTCACCCACTATGACCTGCTGAACCTCAATGGCACCAA
GGTGGCAGAGGGCCACAAGGCCAGCTTCTGCTTGGAGGACACAGAATGTGAAGGAG
gtatctgagcggagtggggggatgggaggcctcagagggactcgaatgcctctgcctcca
cgatcacctggctggagcccaggcctggcactgaccctgtgtcactctgaccactgccac
ctttccccacctggaccttcctcagctatagtgaggcgctgggggcatgggcatgacctg

 5.03 Intr + 103155 103291  137  1  2  100   94   325 0.748  34.59
gatgtgggtagggaattgagtggggggttctactgaaatgagaacagatgagcagcccac
acagtggggtgggatgccgagcccagatgaagcagcggtaggggccttggaagcaggaag
agggtgcggcagtggggccatggttccctggtgatgagctctcctctaccctgcccgcag
ACATCCAGAAGAATTACGAGTGTGCCAACTTCGGCGATCAGGGCATCACCATGGGCTGCT
GGGACATGTACCGCCATGACATCGACTGCCAGTGGGTTGACATCACTGACGTGCCCCCTG
GAGACTACCTGTTCCAG
gtgaggtgggtgggaaggggttccagccctgcagggggaggaggggaggccacctccaca
ggctccttcccattggtgtccacacaggggcatggaagtcaggctgtctaaagggcaagg
tgctacccccagaggccatcacggtccatcagttaacccaaagatatcaggcatgggggc

 5.04 Intr + 106371 106482  112  2  1  101   82   217 0.999  22.35
gctccctgactcatctcttcccctccccaaggactttgttgagacccacagacccccgtc
ttgggtcccggcacctgccacgctccccttccctgaggtgctggtctctcagagccccag
gcctgggtggaggtggccgcagagggaacaagcagcctcctctgccctgcttctccctag
GTTGTTATTAACCCCAACTTCGAGGTTGCAGAATCCGATTACTCCAACAACATCATGAAA
TGCAGGAGCCGCTATGACGGCCACCGCATCTGGATGTACAACTGCCACATAG
gtaaggccaggccgcccccactccaggaagcaggcgggagctgccctactttctcaagga
cccagaggcagcttcctaatttgggtaaagagctcggggaatgcagccagcatcacattt
ccacattcaggacagaagccacagacacacaggcctggatggagactgagtttttacagc

 5.05 Term + 107196 107275   80  1  2  111   43   103 0.950   6.03
tgacagagcacctgctatgtgcccagccctagagatggccagtgcctggcacctgtcctt
ttgaggagggcacacacaggtggccccagcagcccctgaggcccactcccctggctcagg
gtcaggcaaggcccgagcatctcatttgtccactctctctacccgattctcgctcttcag
GTGGTTCCTTCAGCGAAGAGACGGAAAAAAAGTTTGAGCACTTCAGCGGGCTCTTAAACA
ACCAGCTGTCCCCGCAGTAA
agaagcctgcgtggtcaactcctgtcttcaggccacaccacatcttccatgggacttccc
cccaacaactgagtctgaacgaatgccacgtgccctcacccagcccggcccccaccctgt
ccagacccctacagctgtgtctaagctcaggaggaaagggaccctcccatcattcatggg

Predicted peptide sequence(s):


>LOXL2_1|GENSCAN_predicted_peptide_1|155_aa
MRILLKLIYEFNTISITIPADFFAEIDKLIDSKIPVEVQETQISQNNSEKENERLGLPML
PAILKRRLETSLTLVTVEGLPIRLAKRCSLLSKHCIGQQWVHVWNYSACNCYSRLVCGPR
AEWPRATSSEASWTTQGVTAMQTDHKSLSPGGNGR

>LOXL2_1|GENSCAN_predicted_peptide_2|496_aa
MARELRDECTSFSSRFDQPEERVSVIEDQMNEMKREEKFREKRVKRNEQSLQEIWDYVKR
PKLHLIGVPESDGENGTKLENTLQDIIQENFPNLAGQANVQIREIQRMPQRYSWRRATPR
HIIVRFTKVEMKEKMLRTAREKAPHRTYSKIDHIVGSKALLSECERTEIITNCLSDHSAI
KLELRIKKPTQNCSTTWKLNNLLLNDYWVHNKMKAEIKMFFETNENKDTTYQNLWYTFKA
VCRGKFIALNAHKRKQERSKIDTLTSQLKELEKQEETHSKASRRQEITKIRAELKEIETQ
KTLQKINESRSWFFEKINKIDRLLARLIKKKREKNQTNAIKNDKGDIATDPTEIQTTIRE
YYKHLYANKLENLEEMDKFLDTYTLPRLNQEEVESLNRPITGSEIEAIINSLPTKKRPGP
DRFAAEFYQRYKEELVPFLLKLFQSIEKEGILPNSFYEASIILIPKPGRDTTKKENFRPI
SLMNIDAKILNKILTN

>LOXL2_1|GENSCAN_predicted_peptide_3|646_aa
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIEASC
IAFIVEPPGLSPPALFSGGNCPASSQEREQAPLAFGLNLNIQVEDIRIRAILSTYRKRTP
VMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWP
FSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYK
PEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSASVVCRELGFGSAKEAVTGSR
LGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDAGVRCNTPAMGLQKKKMRKAP
QCMKCPDSFQNSQTLLSVLEAIPGLLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWG
IVEAMVVCRQLGLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVA
CPQGGVQYGAGVACSESESSSPPSPPGSQGDQSPTSYSSRDSEALP

>LOXL2_1|GENSCAN_predicted_peptide_4|229_aa
MDKFLDTYTVPRLNQEEAESLNRPITGSEIVAIINSLPTKKSPGPDGFTAEFYQRYKEEL
VPFLLKLFQSIEKEGILPNSFYEASIILIPKLGRDTTKKENFRPISLRNIDAKILNKILA
NRIQQHIKKLIHHDQVGFIPGMQGWFNIRKSINVIQHINRTKDENHMIISIDAEKAFDKI
QQPFMLKTLNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEAFPLKTGT

>LOXL2_1|GENSCAN_predicted_peptide_5|234_aa
MPSSAAAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ