GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:49:04

Sequence FZD3_1 : 72586 bp : 36.94% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1766   1826   61  1  1   52   48   154 0.291   7.26
ggggagctgccccgggagactgttaaccctgtccgccctgagcccgcggctcggcaacct
gtgcgagtgtggaccgcggttcgctcgcctctaccccggctcagaccctgcgcggcggag
agaggggcccggccggagccggcggcagcgcggggtgccgggggccgtaggcggaagaca
ATGCTCCGGGGGCTCCCGGCCGCCCGAAGCGCGCGCCGCCAGGCTCCCGGCCCCGGCTCG
G
gtcagcttcgggcccacctttgcctgcccacgcctgaaagtttcccctcccgtccatcag
tttgcaaagtccttgctcccttccgcgagcttcccccggctgcctcctccgcgggctgtg
ggtttgccgtggggtggctgctgctggatccccgagggtccgcatctgaaatgaagctgc

 1.02 Term +   1887   2011  125  1  2   56   44    91 0.244  -0.93
gaggggcccggccggagccggcggcagcgcggggtgccgggggccgtaggcggaagacaa
tgctccgggggctcccggccgcccgaagcgcgcgccgccaggctcccggccccggctcgg
gtcagcttcgggcccacctttgcctgcccacgcctgaaagtttcccctcccgtccatcag
TTTGCAAAGTCCTTGCTCCCTTCCGCGAGCTTCCCCCGGCTGCCTCCTCCGCGGGCTGTG
GGTTTGCCGTGGGGTGGCTGCTGCTGGATCCCCGAGGGTCCGCATCTGAAATGAAGCTGC
TGTGA
aatagccagcaaggtgaaggagccttgtgtcctttcaagacatgtaaacatcttcctagc
ggtgttttacatcttaggagtcttgagttcgatccctctgttgtaagagaagccaagggt
gcttttcttggctttgtttttaagaacaaaagcacgtgccatgaattgaggcagaggagt

 2.01 Init +  10094  10147   54  1  0   52   94    77 0.593   6.03
attgaataggcctgatcatctgaatctccttcagacccaggaaggatggctatgacttgg
attgtcttctctctttggcccttgactgtgttcatggggcatataggtgggcacagtttg
ttttcttgtgaacctattaccttgaggatgtgccaagatttgccttataatactaccttc
ATGCCTAATCTTCTGAATCATTATGACCAACAGACAGCAGCTTTGGCAATGGAG
gtaagacttgatctattctttgacgtatcttagtaaatgactcttgtgttgtcccatcag
ccaatctaatgaatgtgtttgataaacaacaggaaaataatatgctattttaaattatat
cttataaatttaaaaatgtatatgttttgcttcagactctaatagattgaagaattcaca

 2.02 Intr +  25397  25432   36  1  0   93   84    25 0.476   0.14
ggtctcaaattcctgagctcaggtgatcctcctgcctcggcctctcagagtgctgagatt
acagccgtgagccattgcgtccagccagcagatcactttaattcagtcagtaactgagct
gagtagaggctgcgttgcaatgttggtaggtctctgcctctgatttgtctctgctactag
GGTGTAGTCATTCAGGACTTCTCAGCAGAAAGTCTG
gtatgttgagatgctgtgcagaggttgaacagtaattcatgtctctttagactgataaga
ctgccaaaatctctactctgttctctttctgcttagcttcttagcttccttccctgtgta
gctttagaattttgagatacacatagggaaaactggctttgtgttagactcagtccttcc

 2.03 Intr +  27583  27779  197  0  2   78   52   120 0.860   4.69
tagaatcttcaagggtagggctaggacagttttgtttaaaaaaacaaaaactccccttca
gaaaattttaataaccctcagaattttcttgtaatgagaaagagaatgttgcagtattat
agaaagctttaacttgtatacagctctttaactaattattcaattttaacttttccctag
CCATTCCACCCTATGGTGAATCTGGATTGTTCTCGGGATTTCCGGCCTTTTCTTTGTGCA
CTCTACGCTCCTATTTGTATGGAATATGGACGTGTCACACTTCCCTGTCGTAGGCTGTGT
CAGCGGGCTTACAGTGAGTGTTCGAAGCTCATGGAGATGTTTGGTGTTCCTTGGCCTGAA
GATATGGAATGCAGTAG
gtgcgaaaatcatagattttcatggatcatttcttatgttgcaatatgtttaaaagtact
tgtcttcttttccatctgttttaaaaaactttttttgaagtgtacatattagtcattaat
tttgaacagttttatggcctcacaattgtttatttgcttagaaatttggaagcactaaat

 2.04 Intr +  34092  35109 1018  0  1  108  110   400 0.994  33.92
tcgaaaatctagttgtatggaccacaaacaagatatcaccatttactttatttctacata
ttacatttgctctccaggaataaataaggttgtgagtgccagatttggaaatccaaactg
ttagatcgtgatagatttccccataagtaaaaatagttctcatcttgttttgttttttag
GTTCCCAGATTGTGATGAGCCATATCCTCGACTTGTGGATCTGAATTTAGCTGGAGAACC
AACTGAAGGAGCCCCAGTGGCAGTGCAGAGAGACTATGGTTTTTGGTGTCCCCGAGAGTT
AAAAATTGATCCTGATCTGGGTTATTCTTTTCTGCATGTGCGTGATTGTTCACCTCCTTG
TCCAAATATGTACTTCAGAAGAGAAGAACTGTCATTTGCTCGCTATTTCATAGGATTGAT
TTCAATCATTTGCCTCTCGGCCACATTGTTTACTTTTTTAACTTTTTTGATTGATGTCAC
AAGATTCCGTTATCCTGAAAGGCCTATTATATTTTATGCAGTCTGCTACATGATGGTATC
CTTAATTTTCTTCATTGGATTTTTGCTTGAAGATCGAGTAGCCTGCAATGCATCCATCCC
TGCACAATATAAGGCTTCCACAGTGACACAAGGATCTCATAATAAAGCCTGTACCATGCT
TTTTATGATACTCTATTTTTTTACTATGGCTGGCAGTGTATGGTGGGTAATTCTTACCAT
CACATGGTTTTTAGCAGCTGTGCCAAAGTGGGGTAGTGAAGCTATTGAGAAGAAAGCATT
GCTGTTTCACGCCAGTGCATGGGGCATCCCCGGAACTCTAACCATCATCCTTTTAGCGAT
GAATAAAATTGAAGGTGACAATATTAGTGGCGTGTGTTTTGTTGGCCTCTACGATGTTGA
TGCATTGAGATATTTTGTTCTTGCTCCCCTCTGCCTGTATGTGGTAGTTGGGGTTTCTCT
CCTCTTAGCTGGCATTATATCCCTAAACAGAGTTCGAATTGAGATTCCATTAGAAAAGGA
GAACCAAGATAAATTAGTGAAGTTTATGATCCGGATCGGTGTTTTCAGCATTCTTTATCT
CGTACCACTCTTGGTTGTAATTGGATGCTACTTTTATGAGCAAGCTTACCGGGGCATCTG
GGAAACAACGTGGATACAAGAACGCTGCAGAGAATATCACATTCCATGTCCATATCAG
gtaagggaaaccttgttacaaatttcagaatatatgataatgaaacaaaagcatattact
ataatgagttaatatcagctgttttttgaaatgtcatgaaccttcaacttgtacattaac
attttaaggatgagatgacaaatatgttgtagtaaatatgtaatacacatatttgataga

 2.05 Intr +  58548  58696  149  2  2  107   89    41 0.813   4.21
ggagaattgcttgaacctgggaggcagaggttgcagtgagccaagatcacaccattgcac
tccagcctgggtgacaagaacaaaactctgtctcaaaagaaaaagaaaaagatttcataa
tggcctttaatagaaagttatttttatatatttaagatgcttttctttctgttcttccag
GTTACTCAAATGAGTCGTCCAGACTTGATTCTCTTTCTGATGAAATACCTGATGGCTCTC
ATAGTTGGCATTCCCTCTGTATTTTGGGTTGGAAGCAAAAAGACATGCTTTGAATGGGCC
AGTTTTTTTCATGGTCGTAGGAAAAAAGA
gtaagttgaaataaatgatcacagtgttcacaaacctcacatttacgtaaatttttttgt
gttgcttatgttaaaatgacttggatttggagaattattcaaacaagactaacattttca
gcagtatccagttatgattggcacagtagcatgtcttaatttaaaactaaaaacttattt

 2.06 Intr +  62683  62916  234  1  0   77  109   141 0.986  10.98
attgacatagattgttgttctattctttcctctgtcaacaatgtttcttcatgtcagtcc
tatagatctaatttggcaagcaattaatttcaagaataatatcagtgtttcagagaagta
ttgcttattggtctgaaggaagattggtatgtatcttaaacttactattttgttgtctag
GATAGTGAATGAGAGCCGACAGGTACTCCAGGAACCTGATTTTGCTCAGTCTCTCCTGAG
GGATCCAAATACTCCTATCATAAGAAAGTCAAGGGGAACTTCCACTCAAGGAACATCCAC
CCATGCTTCTTCAACTCAGCTGGCTATGGTGGATGATCAAAGAAGCAAAGCAGGAAGCAT
CCACAGCAAAGTGAGCAGCTACCACGGCAGCCTCCACAGATCACGTGATGGCAG
gtgagttttgttagtagtgtagtttatttcataagctgaattatgaccatacagcttaag
aaagaggagcagccaattctgaaatagaagtcgaacataattaagcctttgaactttgct
agatagagttgtcccagactatggtcagacttaaagtcagtcagaattgtttagatttga

 2.07 Term +  69743  69956  214  2  1   56   28   211 0.624   7.62
ttggccatgtcaataattctacagtgttaacgaagttaagcaatcaaaagttggttatta
ctttctcatggttggtttcctaataatttcccttactgaggcatttttatgaaaattatt
agtgttattatattttctagtgtgttctgttacccacttcaaaataaactctcatgacag
GTACACGCCCTGCAGTTACAGAGGAATGGAGGAGAGACTACCTCATGGCAGCATGTCACG
ACTAACAGATCACTCCAGGCATAGTAGTTCTCATCGGCTCAATGAACAGTCACGACATAG
CAGCATCAGAGATCTCAGTAATAATCCCATGACTCATATCACACATGGCACCAGCATGAA
TCGGGTTATTGAAGAAGATGGAACCAGTGCTTAA
tttgtcttgtctaaggtggaaatcttgtgctgtttaaaaagcagattttattctttgcct
tttgcatgactgatagctgtaactcacagttaacatgctttcagtcaagtacagattgtg
tccactggaaaggtaaatgattgcttttttatattgcatcaaacttggaacatcaaggca

Predicted peptide sequence(s):


>FZD3_1|GENSCAN_predicted_peptide_1|61_aa
MLRGLPAARSARRQAPGPGSVCKVLAPFRELPPAASSAGCGFAVGWLLLDPRGSASEMKL
L

>FZD3_1|GENSCAN_predicted_peptide_2|633_aa
MPNLLNHYDQQTAALAMEGVVIQDFSAESLPFHPMVNLDCSRDFRPFLCALYAPICMEYG
RVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGA
PVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLISIIC
LSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYK
ASTVTQGSHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHA
SAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAG
IISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYEQAYRGIWETTW
IQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSVFWVGSKKTCFEWASFFHG
RRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRS
KAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQS
RHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA