GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:25:51

Sequence FGFR1_1 : 58244 bp : 50.61% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -   1644    916  729  0  0   94   72   318 0.655  23.60
 1.00 Prom -   2845   2806   40                              -5.16

 2.01 Init +  12373  12463   91  0  1   39  116   132 0.225   9.76
agccaccacatggcatactttaccttctgtttttcctttcccctcccctacctagaccct
cctaacttttggggtttttttcctttcctcagggtcagtttgaaaaggaggatcgagctc
actgtggagtatccatggagatgtggagccttgtcaccaacctctaactgcagaactggg
ATGTGGAGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACACTCTGCACC
GCTAGGCCGTCCCCGACCTTGCCTGAACAAG
gtaaggtgctggctgggggcagcctggactcctgggccttgggaacaggatgggctggga
gggaggtgatatggttgcaggtgatgtggtcaacagggaaggctccttcccaagtggagc
aaagaactcccttcctgtaggagaaactctcaagatacctgggttggttctggtctggtt

 2.02 Term +  15514  15704  191  2  2   95   47    65 0.174   0.71
actggagactgagatgagagtgtaaagggagtgagtcagagtgggaggtttgaggggagt
ttagatttgaatccgccaattgtagacagcgataaaggagtggaagagtagcaaggagct
agttgaggtttgagaatgtgaatttataatggagcctaaagtactttcttttttttgcag
CCCAAGAAGGGAGAAGTGGATCTCGGGCCTGGCTGCTTGTGAGCCAGCCCGACGGGATGA
GTATAAGGAACTTTAGGGCCAGGGTGGGGGTGCTAGTAGAGGAGGGGGCTTCACGGAAGC
TGCTGGGGCAGGGTGGAGGCTGGAACCTGGGGGCTGAAGATCTTGATGAGGACAAAGTAC
CGGCCCTGTGA
acagaagaaagggagtaagagaggtggatggggctcttaggagccatgtacccaggaaga
ctgacattaaatgaccattttttaaaaatcaacttaattttcaaaggcacattggctccc
acctataatcccagtactgtgggaggcagaggcaggaggatcacttgagcccaggagttt

 3.01 Init +  29447  29513   67  1  1   48  115    81 0.590   6.99
cggggggctggtggacgccattggccctgggtgtcaggccctgctaattgatttggtgct
cccggctctctttccacacatacctgtgccccccatttttgcagctctccttctatttgg
ggactccgagagttgagagaaacacatttttggggctctctccacccaaacccttgtagg
ATGGCAGCTGTGACCCGGGATTTCGGTGAGATGCTTCTGCACTCTGGCCGGGTCCTGCCA
GCCGAAG
gtaagttttcagttccatttcaaagccaaaatacgtaataaaaaaacctctgcagagggc
ccccggagccccgctgcgctgttctgtgctccttttaagttgctttcaaagccaccccga
gttcctcccccacccacaattgccccctcatttatctctggggagtttataccaagactg

 3.02 Intr +  39871  40137  267  2  0   55   77   467 0.990  39.80
tccccactgacccatgctccaattcccactgccctggctcagtagcctccagtaagtgat
gcccaggatggtgcggctccgtgtggccagcgtaattccctttgtctctcccctcctccc
ctctccctgtcttcctctctcgccccttggcttcccttcccggccccgtggtggctgcag
CCCAGCCCTGGGGAGCCCCTGTGGAAGTGGAGTCCTTCCTGGTCCACCCCGGTGACCTGC
TGCAGCTTCGCTGTCGGCTGCGGGACGATGTGCAGAGCATCAACTGGCTGCGGGACGGGG
TGCAGCTGGCGGAAAGCAACCGCACCCGCATCACAGGGGAGGAGGTGGAGGTGCAGGACT
CCGTGCCCGCAGACTCCGGCCTCTATGCTTGCGTAACCAGCAGCCCCTCGGGCAGTGACA
CCACCTACTTCTCCGTCAATGTTTCAG
gttggtagccaagccctgcccttgcccctccctagacccaccccctccagccctctctgc
cagtttcagaggaaggtgaacctcctccccctccgtgatctgcccccactctgcttcaga
aactgctgcccactaacattgctccctgcctgccgcgtggcttggctctcagagaggtga

 3.03 Intr +  41384  41473   90  0  0  110   29   147 0.707  10.97
caaacacgcacaggaactgttcttaaacagtttccatcccaccaagagatcatcactaag
ggagcagtgggactgggatccccatggggagggtgtccgtgttcatctggaactgcacta
gccttggtgaaatctaggggtccctaggaggaacctcagtgccccttcttcttcccatag
ATGCTCTCCCCTCCTCGGAGGATGATGATGATGATGATGACTCCTCTTCAGAGGAGAAAG
AAACAGATAACACCAAACCAAACCGTATGC
gtgagacactgtttcctatcttactgccctttgggtctgggcattgggtttaagagggga
ggggaaggctgaaaggggaggaagaggagggcacatggggtcacggtgcctgttctgcta
agtgccaggcactgctcacaggtgttgggcagatgggcaagacacctccaggtcctggcc

 3.04 Intr +  41726  41898  173  0  2   82  102   142 0.921  14.66
aaggggaggaagaggagggcacatggggtcacggtgcctgttctgctaagtgccaggcac
tgctcacaggtgttgggcagatgggcaagacacctccaggtcctggcctgggccctgctc
ctgagcctgaccagctgctcctctccaccctgcctgtctctcttggctttccccgggcag
CCGTAGCTCCATATTGGACATCCCCAGAAAAGATGGAAAAGAAATTGCATGCAGTGCCGG
CTGCCAAGACAGTGAAGTTCAAATGCCCTTCCAGTGGGACCCCAAACCCCACACTGCGCT
GGTTGAAAAATGGCAAAGAATTCAAACCTGACCACAGAATTGGAGGCTACAAG
gtacgtgtgtgtgcatgcgaaagttagagtaatgggaacaggggaggccgagttaggaag
tcctgattacatgcttttcatttttttaagtaatactttccacctatacaggttattcat
taaaatttttaaatacaaaaaaatgcaaataaagtttaaacatttcttcagtcttctttc

 3.05 Intr +  43574  43697  124  1  1   99   86   256 0.994  26.66
cagagtgtgaacgggctggtaggggggcaatccacgccttgtcctagccaaccctgcagc
ctggggccctgtgccaccaggctctgatatggagggcaggtgccacggggtgccgacatt
gtcatggggcctgcattttcctctggaccctcaatgtatccctttggcatttcccctcag
GTCCGTTATGCCACCTGGAGCATCATAATGGACTCTGTGGTGCCCTCTGACAAGGGCAAC
TACACCTGCATTGTGGAGAATGAGTACGGCAGCATCAACCACACATACCAGCTGGATGTC
GTGG
gtaagagggcagaggcagcaggaggaatgagtttagtgggaagagccaggcttggagaac
acagccggggtgtccaggtttcttaggggcagagtcaggatagcgattggcacttcttgg
ctttgtcaccttgagcaggtcacttctcccttttgagcctcacttttcttatctgtaaaa

 3.06 Intr +  45120  45310  191  1  2  109   84   264 0.982  27.40
agggcctgaagagagggtgtccctttccccagctctgttttgagaggcttgggctcagca
gaagtgctgggaggtttacaacccatcactgggaaagccaagtggggcgcaggtgagccc
acccctctttagccatggcaaggtccccatgacaagtgcctcctctcccatcttccacag
AGCGGTCCCCTCACCGGCCCATCCTGCAAGCAGGGTTGCCCGCCAACAAAACAGTGGCCC
TGGGTAGCAACGTGGAGTTCATGTGTAAGGTGTACAGTGACCCGCAGCCGCACATCCAGT
GGCTAAAGCACATCGAGGTGAATGGGAGCAAGATTGGCCCAGACAACCTGCCTTATGTCC
AGATCTTGAAG
gtaatcatggcaccagtcttcgtgggccagtctactgggaaggagaccactgtctcgggg
gctcaagttcctgtgggcaggctcagttgcccccgaatgggatcattcctcacgcttcag
gcacacacactccatctcagtagggatctagccacatcccccaggactagtaacagaggt

 3.07 Intr +  45829  45867   39  0  0   88   86    25 0.622   0.72
accaagcgtttcccagtcttagccctgtgtcctgagttacgtacgatctttctggcaaat
ggggtgcatgataagagcatctcttacgaagagttggaaaaacaaatgccatatataaat
tctaagccatatgaggacgaggagtaatggcattttcttcctttttcctctcactcccag
ACATTCATTGTCCCTGAATGCTCCATTAATCCAGGGAAG
gtaattgcctaaatctccagtggatctcgcaacaggaaggaaccagaagctgggaaagtt
gtttacctctttgtcccagagttagacctcatcctcccctagcttagctgtctcagagat
atactggccctcccttctcttctctttgctgctggtgctaaaactgctctgtaggtcatt

 3.08 Intr +  46644  46794  151  2  1   84   90   135 0.781  13.04
agtgagtgagactctgcgttaaaaaaaaaaaaaaaaaaaaaaactaaaagggaaaggtaa
taaatctcacttaacatctcccttcgctccctgggcctgcctgaaagttacacgggagca
acgtgcgtggccacatctcagctttgcccaactgactggtgtgtcgttggtttgttccag
CATTCGGGGATTAATAGCTCGGATGCGGAGGTGCTGACCCTGTTCAATGTGACAGAGGCC
CAGAGCGGGGAGTATGTGTGTAAGGTTTCCAATTATATTGGTGAAGCTAACCAGTCTGCG
TGGCTCACTGTCACCAGACCTGTGGCAAAAG
gtaatggggagatggatgggaccctgtgctggggatttgatgtaggccccaagctgctgg
ggcaggcggggaagccagtactggactgtccttgccaccctactgtatttctagtgccca
gagccatggaaaaatacccggcctgggaggctggtttggtttggtattgtgttggtgtct

 3.09 Intr +  47558  47667  110  0  2   15   46    85 0.765  -3.00
agaatggtaccccatctcttaaaaaagagagagaaggggttaggcattcccttgcatact
cgcatctgctggctgtgtatgcacatgtgcgtgtgtgtatgcgtgtgcatgtgtgtgtct
gcagcccccgccatccctcctgtgttcaccttctggctatctttacctgaaaccaaacag
CCCCTGCCCGCCGGCCCCATTTCTCCATGCCGCTCACCGCCCGCATGCTCGGATGGGCCA
GTGGCTGCCAGCATCTGGTGAAGGGTCGTAACCAGCCATCGTCTTCTCAG
gtctgccggagttcttccctcagggtctcaccctcttcctctaacaggttttgctgcctg
gtggttttcgtttgttccttgttgcaaagaagatgtcagggagcatttcttcctctagtc
ccccttctttctgtctccttcccttgctctgcgtctcttagaggtctcatgtcctgtgct

 3.10 Intr +  47878  48022  145  0  1  105   81    94 0.793  10.26
ccctcttcctctaacaggttttgctgcctggtggttttcgtttgttccttgttgcaaaga
agatgtcagggagcatttcttcctctagtcccccttctttctgtctccttcccttgctct
gcgtctcttagaggtctcatgtcctgtgcttgtccattttgcttccgttgtctcttctag
ACTGCTGGAGTTAATACCACCGACAAAGAGATGGAGGTGCTTCACTTAAGAAATGTCTCC
TTTGAGGACGCAGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCAC
TCTGCATGGTTGACCGTTCTGGAAG
gtacacactgtaacttctcctctcgatgtcctgccctcgccacgggcacggggggagcat
gcatttccaggcttggggagacacagaggcaggagagctggaagaatgggctcctgcctg
cctggtgccacatcctgccccagctttgagggctgaatcctctcagctcagagaagagct

 3.11 Intr +  48425  48522   98  0  2   65   66    21 0.736  -2.67
ctgcctctgctctccccctggccattgcaatgcatgcccgggatctgggtttaccctgca
gcccgactcctccagggcaggctccttccgtccttgggtccagcagcctcccccctccgc
tgggtactgagcatctgaaaagtctcagatagggccctacacctcttctcccttctcaag
TGCTCAGCCCAGGGGTGGGGCTTGCTGCTTGCAAAGAGCAGCCCACCCTCCTGTACTGCC
ATCCTATTGCCTTTGAAGAAGGAGGTCAGCCTGGACAG
gtgaactgagttgccttcagaaaggcctgtctcaggcagccgcagcaggcttcacgatgt
ccatgtatcctgtttgcctgctgccgtctctcctctcccaagaggggaggtctgcgtgtt
gagccagggaggaaggagcctgcagcctgctcagggtggtggctggtgactgcggggcca

 3.12 Intr +  48813  48984  172  2  1   84  -13   138 0.151   2.82
tctgcgtgttgagccagggaggaaggagcctgcagcctgctcagggtggtggctggtgac
tgcggggccagggcttgctgctgtctctcggaatgtcctgcatgtgggtctggctgttcc
tgctggcactgccctcttctctctcccctcctttcccactctgccctgcttgcccgtcag
GGTCTCCGGATGCCCCTGCTGGAGGCAGAGAAGCGTTCTGTTTTTATCATCGTCCCTGTC
TTGGTCCTGTCCGTGCTCCCCATGTGCTCCCAATCAGTTGTCTTCGTTCCTCAACATCAG
GGAAAGAAAAAACAGCAACACTTCTCCCTGTCATCAGCTCTGCTGTCTCCTT
gtcaggccttgggacgttctctgggctcagtctagggtcgtgcctcatgcctcatgcctc
tctgggaaggttcccaggggcgccgcctccatggttggctggtgggttttaaaggggaag
gttgggaggaggcctgtggaaggaggagggccgtccacacccgtggggcaaagcgtgttc

 3.13 Intr +  50084  50280  197  0  2   45   92   272 0.350  22.43
aatcagggggttgcctgatcctcctagtgccacaatcccagtcctagctagaacttgcca
tggttcttctccctaaaagttcccaggggacaggagacaggtgttgcttttctaatggag
cgggacctcgcatggacggggccctccaagcctgctaacaccctgttcgcactgactcag
CCCTGGAAGAGAGGCCGGCAGTGATGACCTCGCCCCTGTACCTGGAGATCATCATCTATT
GCACAGGGGCCTTCCTCATCTCCTGCATGGTGGGGTCGGTCATCGTCTACAAGATGAAGA
GTGGTACCAAGAAGAGTGACTTCCACAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCA
TCCCTCTGCGCAGACAG
gtaacagaaagtagatgggggatttgcacactcagcaccacctctctctctgggcctcta
atgccctgccctctccattgtccctaatttatagctttgggccttattttctggcttctg
ggcaaggcacagtggaatatcatgaactaagtgctctagagtctgtttcaagctagtgta

 3.14 Intr +  51446  51591  146  1  2  119   90    98 0.999  12.18
tcagtcctagaagttgggcctcctggcctaccatggtctttggaccactctgtgttgagg
aaagaacatcagatacacagacatgtgcctctgccattgttgggaagccctgactaagaa
tgggaaggagtcaccccgtcccccctccttgctctagggtgaccccactcttccttgcag
GTGTCTGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTTCTGGTTCGGCCATCACGG
CTCTCCTCCAGTGGGACTCCCATGCTAGCAGGGGTCTCTGAGTATGAGCTTCCCGAAGAC
CCTCGCTGGGAGCTGCCTCGGGACAG
gtaataatactttgactcccaactttttgaaggcattccttgcttgctattctagtggtg
gaaggtgtgtatactaacaccttctgggcggtgaaggttcatgaaatgcctgcagaaaca
ttcattccactttctgctcgcagttgggtgaaatacagagaggtggagatggggtgcctc

 3.15 Intr +  51828  51949  122  0  2   73   84   111 0.937   9.34
ggtggaaggtgtgtatactaacaccttctgggcggtgaaggttcatgaaatgcctgcaga
aacattcattccactttctgctcgcagttgggtgaaatacagagaggtggagatggggtg
cctctcaaggtttgaacttcaccagccccaacttatgccactctctgtttcccccgaaag
ACTGGTCTTAGGCAAACCCCTGGGAGAGGGCTGCTTTGGGCAGGTGGTGTTGGCAGAGGC
TATCGGGCTGGACAAGGACAAACCCAACCGTGTGACCAAAGTGGCTGTGAAGATGTTGAA
GT
gtaagtgatgcttctgtccttgcaaagaaaatcttgtcccattccaagcaaacagcaggc
ctcgggcccagcagaacagcttctctggtgcctttgctgcccacacctgctccgctgcct
gcttggggttacctgggagtggagggggtgttctgcaccttgagattgttctatgacgtc

 3.16 Intr +  52403  52513  111  0  0   45   64   175 0.996  11.15
ctaccacctattgcaacaacggctcccatgagagggaagagaaaacaagtttggatgaag
tggggaggagagaatcaagtcccagggaaaagcagcccctcgacacataccccactccct
tagcctttatcctgccctcctcccttcccaagtaaatgagtctcaacgtgttctttaaag
CGGACGCAACAGAGAAAGACTTGTCAGACCTGATCTCAGAAATGGAGATGATGAAGATGA
TCGGGAAGCATAAGAATATCATCAACCTGCTGGGGGCCTGCACGCAGGATG
gtgggtgccggccagactggctttccctgcccagcggggagaagatctgagctggggtat
cagtcccaaggcctctctcagccacagctagggaagggggttaagagaggctgctttggc
agaggtttaaaatgtgttatctcgggatctgggctccgctcattggtgttcattcaggaa

 3.17 Intr +  53759  53985  227  0  2  118   39   459 0.750  41.70
tgggagtaattatttctctgattttttttgggtagtagaatggatttcccaggtccccta
agaggaggcaggagatgggaggttggccggggtgtgctgctgggggtggggtttctttga
ggtgaagccaaacctgctcacctgctgctggccccatggcctcttctcctgtgcctgcag
GTCCCTTGTATGTCATCGTGGAGTATGCCTCCAAGGGCAACCTGCGGGAGTACCTGCAGG
CCCGGAGGCCCCCAGGGCTGGAATACTGCTACAACCCCAGCCACAACCCAGAGGAGCAGC
TCTCCTCCAAGGACCTGGTGTCCTGCGCCTACCAGGTGGCCCGAGGCATGGAGTATCTGG
CCTCCAAGAAGGTGTGGAACCTGAAGGCTCCCCTGGGTAATGCCAGG
gtgggaacagagcccccctagtcttccagcctgtgacttatcatcttgtggtggcgttgt
ggatgcactgagcactggccctgtgtgccctgtgtgttgtcttaggctctctgggaactg
cagagtcaggagcaccagtgtagccaggtggccttggggtcagactgatgcagggtccga

 3.18 Intr +  54918  55040  123  2  0  122   92   163 0.998  20.88
gtgatgagaagcctggagctggcagagaatgttagaagagggaaagcaaaggttcggggg
gcagagcagtgtggcagaagttctatgagacaagtcggctagttgcatgggtggcggccg
cccagagccttccagctccctcacctccccgcctcccgctctcccttcctccttcctcag
TGCATACACCGAGACCTGGCAGCCAGGAATGTCCTGGTGACAGAGGACAATGTGATGAAG
ATAGCAGACTTTGGCCTCGCACGGGACATTCACCACATCGACTACTATAAAAAGACAACC
AAC
gtgagtgccgacaaggccgccctgtgctggtggtttcatctgagaagcaaggagtggggt
gggctgagaacccaccccccagtcccttcccacctgtgccctcatggccctgcctggggc
cactccaacctcccctgtgctgctttcagggccgactgcctgtgaagtggatggcacccg

 3.19 Intr +  55190  55260   71  1  2  110   56    80 0.998   4.98
ccacatcgactactataaaaagacaaccaacgtgagtgccgacaaggccgccctgtgctg
gtggtttcatctgagaagcaaggagtggggtgggctgagaacccaccccccagtcccttc
ccacctgtgccctcatggccctgcctggggccactccaacctcccctgtgctgctttcag
GGCCGACTGCCTGTGAAGTGGATGGCACCCGAGGCATTATTTGACCGGATCTACACCCAC
CAGAGTGATGT
gtgagtttgtaatagcaattgccagggaggtgtgggatagagagcttctagcactgtaga
gtcctgctttctccctggactgaggagtcctctttctgccccagagagaaaaacaaaaca
ttgtctgtggccattccctctgctccagatgttgaaaggctgatctgttctccatgctgt

 3.20 Intr +  55530  55667  138  0  0  110   61   214 0.999  20.48
ctctttctgccccagagagaaaaacaaaacattgtctgtggccattccctctgctccaga
tgttgaaaggctgatctgttctccatgctgtctcctggcactgccctgggtagaggattt
gtgctgggggaggggaggcggagaagctctaacaccctgtggctctccgcccatttgcag
GTGGTCTTTCGGGGTGCTCCTGTGGGAGATCTTCACTCTGGGCGGCTCCCCATACCCCGG
TGTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCACCGCATGGACAAGCCCAG
TAACTGCACCAACGAGCT
gtaagcccgaggagatgtcggaggccctgagccaggccttggggcaagagtgggcttgag
gggcagggggctagactagagagtatccatctccaggagacgtccctgaccttacagtcc
tgccgcaggtacatgatgatgcgggactgctggcatgcagtgccctcacagagacccacc

 3.21 Intr +  55796  55901  106  2  1   35  110   195 0.999  16.62
tgctgaaggagggtcaccgcatggacaagcccagtaactgcaccaacgagctgtaagccc
gaggagatgtcggaggccctgagccaggccttggggcaagagtgggcttgaggggcaggg
ggctagactagagagtatccatctccaggagacgtccctgaccttacagtcctgccgcag
GTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCACAGAGACCCACCTTCAAGCA
GCTGGTGGAAGACCTGGACCGCATCGTGGCCTTGACCTCCAACCAG
gtaaggctgcccgtgccagagccagagctcaggccgtccccactgcgtgcacgcacctcc
ctgagcagggaggaggggcccggcccatcgctgcttcctctcgcccatcacaggagtacc
tggacctgtccatgcccctggaccagtactcccccagctttcccgacacccggagctcta

 3.22 Term +  56015  56191  177  1  0  103   42   196 0.962  14.19
acagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctc
caaccaggtaaggctgcccgtgccagagccagagctcaggccgtccccactgcgtgcacg
cacctccctgagcagggaggaggggcccggcccatcgctgcttcctctcgcccatcacag
GAGTACCTGGACCTGTCCATGCCCCTGGACCAGTACTCCCCCAGCTTTCCCGACACCCGG
AGCTCTACGTGCTCCTCAGGGGAGGATTCCGTCTTCTCTCATGAGCCGCTGCCCGAGGAG
CCCTGCCTGCCCCGACACCCAGCCCAGCTTGCCAATGGCGGACTCAAACGCCGCTGA
ctgccacccacacgccctccccagactccaccgtcagctgtaaccctcacccacagcccc
tgctgggcccaccacctgtccgtccctgtcccctttcctgctggcaggagccggctgcct
accaggggccttcctgtgtggcctgccttcaccccactcagctcacctctccctccacct

Predicted peptide sequence(s):


>FGFR1_1|GENSCAN_predicted_peptide_1|243_aa
MEPELVPRRRGGGRAPVRHPGSPDLVPPSSRTQRRRLTFLADRAPSPCGGPGAAACPTAA
RVPCALRGAPSSDRRKVLGFRGFSSSGALAAGEGEVAAMRYEGSRSRPDVAAQLPAHPGS
SARCGCTGVPAPASCRPPPRTPRLWPQERSERYAPAGREGSLSHSHPRWSLLRLRPLQLP
AGPCSSPAAAPKDGERAELSGALPFSSYSLVSFGVCAPASEHVPEGAGMSGPRHSSGLGA
RGQ

>FGFR1_1|GENSCAN_predicted_peptide_2|93_aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQEGRSGSRAWLLVSQPDGMSIRNFRARVG
VLVEEGASRKLLGQGGGWNLGAEDLDEDKVPAL

>FGFR1_1|GENSCAN_predicted_peptide_3|1014_aa
MAAVTRDFGEMLLHSGRVLPAEAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLR
DGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDD
DDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTL
RWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVV
ERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYV
QILKTFIVPECSINPGKHSGINSSDAEVLTLFNVTEAQSGEYVCKVSNYIGEANQSAWLT
VTRPVAKAPARRPHFSMPLTARMLGWASGCQHLVKGRNQPSSSQTAGVNTTDKEMEVLHL
RNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEVLSPGVGLAACKEQPTLLYCHPIAFEEG
GQPGQGLRMPLLEAEKRSVFIIVPVLVLSVLPMCSQSVVFVPQHQGKKKQQHFSLSSALL
SPSLEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLA
KSIPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKVWNLKAPLGNARCIHRDLAARNVLVTEDNVMKIADFGLARDI
HHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEE
LFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLD
LSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR