GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:35:22

Sequence FGF17_1 : 7732 bp : 61.39% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +     80    275  196  0  1   38  101    89 0.159   4.88
aagcatggacttttccattctggctattccattcactagctgggccattctgagcaaact
acctcccaatgtgcctcagTTTCCTCATCTGCAAAATGGGCTAGTCGCTGGCATTGTACCGAGCAGTATGAGACCGGAG
GTCATGGGAAGAGGCTGGTAGGCACTTCATCCCAGGCAGCTGCTCAGGGACATGGGACAC
AGGGAGGGGACTCCGAGCTGCTCCTAGCTCAGAGAGGCTCTAGGGACAGGCACTGGAAGG
AAGGGGATGCAGAATG
gtgagtggagctgggtctcagaacacagacatcttgaagtctgctatgtgctgatttcac
acttgaccccccaacaccctgaggcattactgtcctcatttctcagatggaactacagag
gcccaaggaaaaggggcttaggccaggacacccagctcttctccaagtgtctgtctcagg

 1.02 Intr +   1429   1465   37  1  1  102   96     3 0.196   1.90
taagtgtgctacctctcccactggagtttcgttgccatttccagcctcagggcagccctc
ctcttcccgggactcccacgcgtgcgtgcacggggctggcagggcgggggcgggggcctg
ggtgcaccctaggcttgcagctggcacccacacctgggcttacctcctctccccacacag
GTGCTTACAGCTGCTGATTCTCTGCTGTCAAACTCAG
gtaggcgggcattcccaccggctttcccccaatttttccaccctacctgaccagggcggg
tgcaagggaccggctcctttcaggtggacagaggcagagtctggcctctccctgggtcca
ggaggcactgaggtttggaggggagtgagcctttgaccgggtgggcagggaagggggctg

 1.03 Intr +   4398   4575  178  2  1   16   77   300 0.178  22.39
agaggttatgaccggctcacccaggggcctgggaaggctatggccatatgcccacttcac
tctgcaggacaagtggcctgtccccactatattcacctcctcacccctctcccttggatg
gaccagtggtggtgtcacccaaagcaaattgacactatttttcccttggtaaccgcaaag
GGGGAGAATCACCCGTCTCCTAATTTTAACCAGTACGTGAGGGACCAGGGCGCCATGACC
GACCAGCTGAGCAGGCGGCAGATCCGCGAGTACCAACTCTACAGCAGGACCAGTGGCAAG
CACGTGCAGGTCACCGGGCGTCGCATCTCCGCCACCGCCGAGGACGGCAACAAGTTTG
gtgagagttggccctccccccagggcacccacacctccactctgcctcacttccaccctg
cctcacctcctggtccatccccagatcctgtgtcagggctgagggccccaagggcctgag
tgtccccaaccccttcgcctgagtctggaggtcagtgtggctgggtggtcccctgctgta

 1.04 Intr +   4811   4917  107  0  2   82  100   193 0.986  21.00
ccctgcctcacctcctggtccatccccagatcctgtgtcagggctgagggccccaagggc
ctgagtgtccccaaccccttcgcctgagtctggaggtcagtgtggctgggtggtcccctg
ctgtagccataggccggcagccccgatggacggaggtctttctcccctcccccaccacag
CCAAGCTCATAGTGGAGACGGACACGTTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGA
GTGAGAAGTACATCTGTATGAACAAGAGGGGCAAGCTCATCGGGAAG
gtgaggctgggagactgggaagtaacagagaatcagccctactggggtggggacatatag
ggcatcatgctcccctctctcctctgagccacacaccctcctgtgtaaagacttcccatc
ctactctcagcccacccactgggccactctctggtttttattttagagtccgggtcttgc

 1.05 Term +   6240   6533  294  2  0  112   34   484 0.955  41.73
ttcttgttggccactgttgcctctctaaataggatgccatctcaccaggcagagttccct
gggctcacggccccgttgttcccgttgtccctcctcagtcgtccaaaataggccgtaagg
gcgacaccccagaccagggtaggtggacaaatgcccttcctgtccttgcttctcccgcag
CCCAGCGGGAAGAGCAAAGACTGCGTGTTCACGGAGATCGTGCTGGAGAACAACTATACG
GCCTTCCAGAACGCCCGGCACGAGGGCTGGTTCATGGCCTTCACGCGGCAGGGGCGGCCC
CGCCAGGCTTCCCGCAGCCGCCAGAACCAGCGCGAGGCCCACTTCATCAAGCGCCTCTAC
CAAGGCCAGCTGCCCTTCCCCAACCACGCCGAGAAGCAGAAGCAGTTCGAGTTTGTGGGC
TCCGCCCCCACCCGCCGGACCAAGCGCACACGGCGGCCCCAGCCCCTCACGTAG
tctgggaggcagggggcagcagcccctgggccgcctccccacccctttcccttcttaatc
caaggactgggctggggtggcgggaggggagccagatccccgagggaggaccctgagggc
cgcgaagcatccgagcccccagctgggaaggggcaggccggtgccccaggggcggctggc

Predicted peptide sequence(s):


>FGF17_1|GENSCAN_predicted_peptide_1|270_aa
XSSSAKWASRWHCTEQYETGGHGKRLVGTSSQAAAQGHGTQGGDSELLLAQRGSRDRHWK
EGDAEWCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHV
QVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKD
CVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFP
NHAEKQKQFEFVGSAPTRRTKRTRRPQPLT