GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:47:34

Sequence ELP3_1 : 100341 bp : 40.11% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1207   1225   19  0  1   81   86    26 0.297   2.05
gttagttgcaacacggggcggggcgtggctttgtgcacgtcggcttccgggaagagcttt
acgatacattgaccgacattttacgacaggcgggattgttttgtggctgtcagctttccc
cgtggtctgagtttgtggctgcatttttatctctggtggctctgctacggcggcgcagaa
ATGAGGCAGAAGCGGAAAG
gtgcgaaaggggaaggagatgggggaaaggggtggtccgaaaggggcgaacgcccaggca
atcaaatgctgaaccgaacttttaccgcgagaatccgctacccagtccagtcgccccgcc
acctagggtcagtgtgtccattctggtccccgagccttctcgtttttcctgttttgcttt

 1.02 Intr +   5211   5310  100  1  1   57   97    93 0.579   5.35
gttttaaagatacaaaagatatgatcaaattgtaaacagtagagatttagcatcttctga
acttgagctattcatttggcatatttgtatggtttcggatggaaaactgctactaaatca
gattttaaaatcttgattgaatgatacgatttttgacattgttgaatattaactttccag
GAGATCTCAGCCCTGCTGAGCTGATGATGCTGACTATAGGAGATGTTATTAAACAACTGA
TTGAAGCCCACGAGCAGGGGAAAGACATCGATCTAAATAA
gtaagtggatataaagagagagcaagcttgttcttaggtagcagatctcttttatgaaat
tatctagtactacttgttttccagctcaagttttattttagttgagaattttagctttct
gccttgccttgtcattcatttctttttttttttttgcaagttccgcctctggggttaacg

 1.03 Intr +   7820   7958  139  2  1   68   84   173 0.440  14.45
ttcactcgtgaattttattcttctatttccctgatagtcacagatcttaaaactatcctt
gtcacgtggtgaagggattggagagtgacagttgttaatgatgttgtttatagatcatcc
tcttggtagcttgtccttaaataaccgtaatcttgataatgtgagatgctttactttcag
GGTGAAAACCAAGACAGCTGCCAAATATGGCCTTTCTGCCCAGCCCCGCCTGGTGGATAT
CATTGCTGCCGTCCCTCCTCAGTATCGCAAGGTCTTGATGCCCAAGTTAAAGGCGAAACC
CATCAGAACTGCTAGTGGG
gtgagtgattcgactcatgaggtatcgacacactgggtatctgttctggcagaagtccct
gctccatgtgacgcccgtgtagtgaggtagaggttggggattctgaactaatgaagtccc
tgtattaggatatgtgctggagtggagacctgtgctgaatgcaaggagagcagagagaga

 1.04 Intr +  13913  13998   86  1  2   52   72    71 0.325  -0.40
tctctttccatgtttatagctacttctctgatagtaagaagcctggcttgctttcacttt
tgtaaatggccagatttgaccaagtgccctggatgtaaccaatcttgcgtctctgccact
gcctcctgtcgtcacctcactgaggctctgtcagacccctctgaggttatttacacccag
ACCCTGAAACATGAAGCTGCTAGTTTAATAGTACCTGCTGCAAATATTGAGATCCAGTGT
GTTCATGAGGCGTTTGAGTCACAAAG
gttaggtttatatataatttcatagaattgcttaaagaaatttttttcttacaggctgtt
tactaagacaatcagagagagaaagactaagaatcactttggctttaacagttaatttgt
tattttgtacttaatttattgtaaaatggaatataacttcacatatatattacatacgga

 1.05 Intr +  15905  15968   64  2  1   76   77    74 0.891   2.90
tatttacttcttggtagaaaatacattatttacagatactgcaaaggtagattcttctgt
taggatttgaaaaggaagctcatttgttatcaggattctttggagatggtagatgcttgg
aactagctgattgaactcagttttgcatctgacattcttgttcttttgttgtactggcag
ATACTGCCCTGGTGGACCTGATTCTGATTTTGAGTATTCCACCCAGTCTTACACTGGCTA
TGAG
gtacagtaactttgaggctgtcctgatgaaatgttgcatcatgctttacctgtagtatgg
ttttaccagtactggctttctgacaattttttgtttttgtttttgtttttttctgatttt
aaaagctgttcattcaccaaatatttgccagtgtctactagtgccctatattattctagc

 1.06 Intr +  18362  18430   69  1  0   78   88    38 0.688   1.26
ctgccagatgcgattcaggacattattttgaaccctgacaagactgagaaaaattaatgc
gggtacaagccacgttttcagtgttcggaaccatggagagttttttttaaaatacagtcc
ttttgaaactactttttagttttaattcaatgtgggcataacaatatttttctcttctag
CCAACCTCCATGAGAGCTATCCGTGCCAGATATGACCCTTTCCTACAGACAAGACACCGA
ATAGAACAG
gtacatttttaaaaaacatgtttcttaaaaattaggtgtttatacttagtaagaagccat
tgttgcttgattcaaattgaacctgaaataagaatgaaaaaggtgtttttcctctttgta
agttttcaatatccatttgagggagggagaatttgccatgcctagcaaggtcaaaaacac

 1.07 Intr +  21011  21165  155  1  2   71   71   166 0.859  11.15
cacttttttctttcagacttgggcctattttttatccacagaattagctaagtgtgtttc
attacttctgatttttaaactgtactgatgaaaacactgcaaaataagagatttgcaatg
ccttcttagagtagttccttatgcttatatcattctaatgctgatgaatttgtctttcag
TTAAAACAACTTGGTCATAGTGTGGATAAAGTGGAGTTTATTGTGATGGGTGGAACGTTT
ATGGCCCTTCCAGAAGAATACAGAGATTATTTTATTCGAAATTTACATGATGCCTTATCA
GGACATACTTCCAACAATATTTACGAGGCAGTCAA
gtaagaaattcttattttatcatagtctccagagtggttgtcagtttatgctcctagcag
tagtctacgagaatgccttctgccctgcatccacattcttacttctcataatctttcttg
tttcatgggaaaggattatttcagtgaaaataatgctttcgctgaaataatcttttccag

 1.08 Intr +  21674  21814  141  2  0   34   77    88 0.459   0.85
tagctgctgtaaaatcagcaaaacaaggtactgttatttaaaaacctaatttatagtaaa
tatttcataattattaaatagtaactgtttatgattgggatcttagtctgtgttgtgctg
ctgtaacaaaatatctgagactaggtaatttataatgcacagaaatgtattggctcacag
CTTTGGAGGTTGGGAAGTCCAATGTCAAGGTGCTGGCATCTGGCAAGAGCCTTCTTACTA
CGTCATCACACGGCAAAAGACAAGAGAAACAAAAAGCGGACCAATTCACCCTTTTATAAT
GGCATTAATCTTACCCACAAG
gtcagatcgcctctcagaggtcccacctgttaatactgttacaatgacaatttcaacatg
agttttagaggggacaaactcatgtctgtcaaatcatgtgttattcaaaccacaagttaa
tttagtcattttgaattctagttgacaaaattatgcatcattttgacaccttgtttttag

 1.09 Intr +  37494  37655  162  0  0   69  110   128 0.875  11.27
atccccatgtgcatagttaggaagtagcagagccaggatttgaactcaggcagcctggct
ccagagcctacactctttaccactatctcatactaggaggacagagagaaggcagttttt
tgagacagagtaatgtcttaaaacctgcaacaggttaattattttagatttgctctacag
GTATTCTGAGAGAAGCCTCACAAAGTGTATTGGAATTACTATTGAAACCAGACCAGATTA
CTGCATGAAGCGACATTTAAGTGACATGTTGACCTATGGCTGCACAAGGCTGGAGATTGG
GGTGCAGAGTGTTTATGAAGATGTGGCTAGAGACACCAACAG
gtaagatggtggcaggtgatcttgcacaagtcttcctccaagttcaccattttctctaca
ttcatacccagcctttcttccttctgaccactcttagggaaagaagtatgggtattcctc
cttttcagagttctttcttctgtctgtgttcttaattccatcccctctttccctcatttt

 1.10 Intr +  40270  40396  127  1  1   49   98    48 0.948   1.66
atgactttctgagatgtcttttcccccagccatatgattttggttatggaacttctgtta
cctgtctcagagattgttttccccttgttccttgtgttaactttgtcacccatttatttg
tgtaacagatgttacacaaataggtagtgattttcacaggtagtgattttctttccttag
GGGCCACACTGTGAAGGCAGTGTGTGAGTCATTTCACCTGGCCAAAGATTCCGGTTTTAA
AGTGGTGGCCCATATGATGCCTGACCTGCCAAACGTGGGACTAGAAAGAGACATTGAACA
GTTCACA
gtaagtgtgacttcagccaggcgcattcagaatggctctgcatgtttcttatcccatctg
gtcttgttgcttgttcactgttgatgttttccagtgttaaagaaatgcatccttattata
gaatattagaaacacagtagggtaagagacatcacccatagccccatcagacaaaactct

 1.11 Intr +  45690  45883  194  2  2   79   57   229 0.393  16.27
ccccagtgagactacagaaacaaggagtttctgttctgtctgtacgccctacctggtcag
aagcaaaggctgccccagggcctactgggtgtgccagagaagctgtcaggggttgagatt
tcaccctcggtgatctctgcataactaatggagaagtcattttctgttctctattcacag
GAGTTTTTTGAGAACCCTGCTTTTCGTCCCGATGGGCTGAAACTCTATCCTACCCTGGTG
ATTCGTGGGACCGGGCTTTATGAGCTTTGGAAATCAGGAAGATATAAGAGTTACTCTCCT
AGTGACCTGGTTGAATTGGTGGCTCGGATCCTAGCCCTCGTGCCTCCATGGACTCGAGTG
TACCGAGTACAGAG
gtagtgtgttatcttttattcctaaaatagttggtgactagtctgtttactatttctcat
ggaaatagtctgatttcatattgagggttttggatttttcttaatggaaataagataact
ggaatgctatctgtaaatagggagggatggaaatcatagcatgtctaagccactttgcca

 1.12 Intr +  63934  64024   91  1  1   83  110    39 0.272   4.68
agaaagctgaggcatagagaagctccttgttaggaggctttgcctctgatttcctggtca
gcttcataggttttttgcttttttatttttgttctttttaacttttttaatatccttgcc
ttactgctgtggagaatgatttctattttgcaacagcttatgtttttctcctgtgtacag
GGATATTCCAATGCCTTTAGTTAGCTCAGGAGTAGAGCATGGTAACCTGAGAGAGCTGGC
ACTTGCAAGAATGAAAGACCTCGGAATACAG
gtaagagcaaatatggcggtcaggccacaactgttgagaaaaagagaaatctgaaacacg
aaagactttgccactaccacccctaaaaccagacttgcgggtcaggtcagaaagctccca
gatgttgaaagcatagtcactgaactgtgtcggagctgaagccagtggtgcaggggctgc

 1.13 Intr +  66560  66625   66  1  0   89   92    88 0.990   7.48
aaggtggttttattttgaaattcagctcttttatctcactgcaagttatatgcaaactta
attttgagcccagggtttggtggagaggtttaaataaaaataaagattgaattggttacc
agttttatatttgtacccctcccaccccccaaccccgctcacgccatttttttttgacag
TGTCGAGATGTGAGAACCAGAGAAGTTGGAATCCAAGAAATTCATCACAAAGTACGGCCA
TACCAG
gttagtctcttcatgtcatagagggcctaggtactgtccttagatctttgccaaccctgg
gcccacatattcttaaccaaggacagagccccaggagtgaataactaagagcagagacta
atcgaggattagataccggtgtcaaaccgtgaaagccaaatacaagaattctagaagagc

 1.14 Intr +  68221  68448  228  0  0   77   68   197 0.898  13.74
caaggtgtgaactttaatcttggtgctatttgagagtagacaagtaaaaagaaacataat
tagtgattattcattccttatccctaactagatattaacctaaataaatacatacaatta
caaaaatgaatttggttctttaattttgaataatattttttgtggctttttactaaatag
GTTGAATTGGTAAGGAGAGATTATGTTGCAAATGGTGGCTGGGAAACATTCTTGTCATAC
GAAGACCCAGATCAAGACATTTTGATTGGCCTCCTACGATTACGCAAGTGTTCAGAAGAA
ACTTTCCGTTTCGAATTGGGTGGAGGTGTCTCCATAGTACGAGAGCTGCATGTGTATGGG
AGTGTGGTCCCTGTGAGCAGCCGGGATCCTACTAAATTTCAGCATCAG
gtatcctgtattccatttctatttgacttctaagaaactgcctaagtaggaaaagagaaa
aggaatggggtgaagagaagaggaagaggcagaggagcaggagaggggaaagagaagcat
agaaacagaggagccagtgttttagttgttcagagatgttttctctccaaattgtatcct

 1.15 Intr +  69989  70070   82  1  1   99   93    82 0.963   8.09
tgctacagtgtacctttggtaggattgaatggtttctttttccttactcccataagtggg
ctttttcactcttaacagattttagcaactactaaagtatatagccttcttgttttatgg
acccctcttaatgaacttccttcctttttaattcccactccccattgttgctccgtgcag
GGATTTGGCATGCTGCTGATGGAGGAAGCAGAAAGAATAGCTAGAGAAGAACATGGGTCT
GGGAAAATCGCTGTGATATCAG
gtaactgggggagggcgaagttcatgattccttcccattttgaacttggcaccacagtga
aaactatgttggtaccctcttgcccctgttgatggttattacgttcaaaattgagctgag
ctgactggcgaaggacttgtgctcaaacaaaattcacaaaagcagtttagtggaatagag

 1.16 Term +  71894  72081  188  0  2   57   38   119 0.367   0.47
ctgcacatgtgtctgtgtagagttgataacacctgaaatttccatggccccttttgtcag
agcactgttagcgttctagtaaagtgcttgtgaaacttcagtgtgcttacaaatcacctg
gagatcttgttaaaatgcaggctctgtctcagtgggcctgggtggggcctgtgctcccag
GTGATACCATGCTGTCTTCAGACCACACTTTGTACACAAGGAAGGCTTTAGTATTCTCTT
CCAAGTGTATTCTCTTTTCAGTCACTGAGATAACGACAACGCTCTGTGATCCTTGCAGTG
CTACACTCCCAGAGTCTGATAATAGTCAAGTGACTTTCTGGTGTCTGTGGGAACCTAATC
AAATTTAA
aatggaagagcatgcatattccatcactgctctacatcatttcgtctgcctttatgacat
ctgtgtctttttacactgttgcatgcagagaggacccctggcttgcctgaggtcatatcc
aattgctcataagagcctcagtttctgctttttatgagcggggtgatttccattttctaa

 2.01 Init +  89515  89575   61  0  1   86   78    63 0.750   6.56
ttttagaaatggtgactgcaatttatcaagttgttactgaaaagtatcccccttcccatt
ctcacatttgtaagctgaatctgtttacaaagtttattattgcctgttatcagacccttt
tctgtgatttattcttcagtttcttactaagccatattgttaacaatggaaatagccacc
ATGTTTGTTTCATCTAATGAGTTATCAAAGGACATTGAAAAACTGGACACAGATACAGGA
G
gtgaggtgatcaagacaaatggcaagttctttctttaccagaaaagaagggatgtgcttt
cccacgaagactagaggtgcaagaccagagtcaggggagttgagtgggcctaccccatca
cataggtgccaggcgcattagaaacgctctgggccatggggtcaggcaggctgggtctca

 2.02 Intr +  92133  92383  251  1  2   91   50   100 0.399   2.73
gacgtcagctctgaaggatgattgctttttcttggctggctaacaaaaggaaagttacta
tgacagaggactttctgggagccctgctgagcatggagaggggatcagagcagagcaagg
ccctcacccagccttggtggctaagtgcaggggtaatgcctttcccaacctgttctgcag
GTTGTAGAAACAGGAGGAAATTTTTCTTTCAAAAAACAAGAGGCAGAAAGAAATTTAGCT
CTTTAGGTGAGCAGAGGTTAGAGTCCAGACTGACTAGAGGTGAAGTTCCCTTCCCTGGAT
GCCAGCACTTCTCAGAGGACCTGGAGACAGTGTTCCATCTCAGGGCTGAGCTCGCCATCT
CAGGCCTGCTGCGTCTTATTGAAAATAAGGACAAGAACTTCAATATACAGCTTTCCTCCA
AAAGGCCCATC
gtgaggcctgagtgcccctgcccaaggtggtaatcgtttctagggcacaccccctgtaga
aaggaaaaagtagaaggcccaaggagcctgtagctccgtgggaatcatgatgagaaatgc
ttagatgtaccccagtaaagcagctcttttaaccagcatgcttaagaaatcagggcactc

 2.03 Intr +  95064  95199  136  2  1   77   15    65 0.054  -2.68
aggagacaaatacctaacccatagcactccctgtgtctctttaagaacaacaaaagcttc
caaaatcagagtcttcagcatcttggcatgaatgtctagcagccattccacatgcagcct
gactggagccccactcctgattcctcttgcaagctcttcccaccatctcctcactcccag
GCAGTGGTGGCTCCTGTTTCTCCAGACTCTTCCTTTACTCAGGCTAAATACCCTGGAGTC
GCCTTGGCTCCCGTCACACCCCACATCCGTTGGCAGATTCTTTTCACTCTGCCTTCCACA
TATGCCCAGGCTCTGG
gtacttttcaccactgtgactcagcccgagccaccaccatctcccacctggattattgtc
atcgcttcctacctgatctccctatttctgcccttggtcacatatccattcagtgagcaa
atatttaccgtgtacctcacatgtgacaggcatcactctgggtactggcagctctacagt

 2.04 Intr +  97301  97383   83  0  2   90   76    68 0.337   4.24
tacttccaacacttctgacagtagccacaagtgtaccttcgctactggggctgagtggag
atcccattttttcccccactcttctctctttaaaacttctgggaaaccgtctatcgtttg
gcctcatctggagcataggcagctcagacagtaaatccacctcttctccttcacctgtag
CACCTAAGGTGGTGCCTGGTGTTGCCAGTAGGGTAGTGAATACGCAGGCTCCAACACACG
GGTGCACACGTTTGCTGTTGCCT
gtgagtgtgtgtgtcacataccctgagcttgagttaaaaatcagggaaagagtcttcttc
tctccacttagcagtttctatattttaatgcagcctgaattcaaagtaataatgttccaa
acttattaagctgagattttatgtgggagagaatttggtctctgggtgggagagagtgta

 2.05 Term +  97666  97947  282  0  0  -35   54   209 0.152  -0.36
aaagtaataatgttccaaacttattaagctgagattttatgtgggagagaatttggtctc
tgggtgggagagagtgtaaggctgagggaagcacatgccgacttttgagaattgctaaag
tgaatgctccttttttaacttcgatttttctgcaggggtcggcaccaggaattattatag
AAAGATCGGCTACAGATTACAAGGCCCGTACATGGTGAAGATGCTGAAATAATGGCCACA
CCAGTCCACTCTTCTGCAGTATCCTCCCTGGCAGAACACGGAGAATCAGGATTTCTTAAA
TACTCAACAGAGAGGCTGAGCAGAGCAAATGGGGGGCTTCACCCTCATCCCGCAGCTGCA
GAGACTGGAAACTGCCTTCAAGGCCACGGCTGGTCATCTGCTGACCACACCCCAGATCCG
CCCTCTCCTGCGTGCACCCCAAAAAATCACTTGCGTTTTTGA
ggcttaaatcatctatccagtttctacattttgcatgaggcctgcaggtggcctattttg
actcagacggtgaaaaaagcaaattaactcatttggacaccataactcatgcaataaaac
tgattgtcattcgaggagcaaacttaagagtagtttatttatataccctggggacagaaa

 3.02 PlyA -  98106  98101    6                               1.05
 3.01 Sngl -  99987  99706  282  0  0   21   49   258 0.732  10.44

Predicted peptide sequence(s):


>ELP3_1|GENSCAN_predicted_peptide_1|636_aa
MRQKRKGDLSPAELMMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDI
IAAVPPQYRKVLMPKLKAKPIRTASGTLKHEAASLIVPAANIEIQCVHEAFESQRYCPGG
PDSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRIEQLKQLGHSVDKVEFIVMGGTFM
ALPEEYRDYFIRNLHDALSGHTSNNIYEAVNFGGWEVQCQGAGIWQEPSYYVITRQKTRE
TKSGPIHPFIMALILPTRYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQ
SVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQFTEFFENP
AFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRD
IPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYV
ANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELGGGVSIVRELHVYGSVVPVSSRD
PTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGDTMLSSDHTLYTRKALVFSSKCILF
SVTEITTTLCDPCSATLPESDNSQVTFWCLWEPNQI

>ELP3_1|GENSCAN_predicted_peptide_2|270_aa
MFVSSNELSKDIEKLDTDTGGCRNRRKFFFQKTRGRKKFSSLGEQRLESRLTRGEVPFPG
CQHFSEDLETVFHLRAELAISGLLRLIENKDKNFNIQLSSKRPIAVVAPVSPDSSFTQAK
YPGVALAPVTPHIRWQILFTLPSTYAQALAPKVVPGVASRVVNTQAPTHGCTRLLLPKDR
LQITRPVHGEDAEIMATPVHSSAVSSLAEHGESGFLKYSTERLSRANGGLHPHPAAAETG
NCLQGHGWSSADHTPDPPSPACTPKNHLRF

>ELP3_1|GENSCAN_predicted_peptide_3|93_aa
MGSACSCDGFTLRPAELCPTELSYEVAPQASEQTDQPDSGGAKHHPCRNEPWQSQEKRKL
LVAEGGGSSATRGKLPNCCRFAQATRYGKEGQG