GENSCAN 1.0	Date run: 17-Jan-104	Time: 00:34:40

Sequence DOK2_1 : 6690 bp : 56.92% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1263   63  0  0   49   97    57 0.922   3.80
actcagaagaaaccgcagggcctatcagcctgtcgtcatcgagcagactagaatagtata
gaaaaccctaggcagagaggaaatgaacttcagagaagggaaacacacggctaagaagag
agaggcaagggcaggagtgaaggagagagctgaagcctggggctccgagatggtcagagg
ATGGGAGACGGGGCAGTGAAACAAGGCTTCTTGTATCTTCAGCAGCAGCAGACGTTTGGA
AAG
gtaggagtgaggctgggctggggttgggcagggggcctgggaggctgctagaattcctgg
gttggagagggagtttcatattcaaaacccttataggtctgactgtgcacccaccaagtt
agacccagagctcaactttgggagggctcttttcctacccgacgctgtctcctgaaccag

 1.02 Intr +   2292   2573  282  2  0   75   86   429 0.999  39.56
cctgcagtcactgtcctcttctctgcctccctgggtctcatgtgatcttcacctctctct
ccccatctccaagtggctgccccagtccccctcccacggttcctcttctccccttggctc
acgatctccccgtctctgggtggctccctcccgcccccgcctcccacgcctctggcacag
AAATGGCGCCGCTTCGGCGCCTCACTGTATGGAGGGTCGGACTGCGCCTTGGCCCGGCTG
GAGCTGCAGGAGGGCCCGGAGAAGCCTCGTCGGTGTGAGGCTGCCCGGAAGGTCATCCGC
CTCAGTGACTGCCTGCGGGTGGCCGAGGCCGGCGGAGAGGCCAGCAGCCCCCGGGACACC
AGTGCCTTCTTCCTGGAGACCAAGGAGCGCCTGTACCTCCTGGCGGCCCCTGCAGCGGAG
CGCGGCGACTGGGTGCAGGCCATCTGCCTCCTGGCCTTCCCC
gtgagtcgcgcggggtgcggaaagggcaagggggcgtgcaggccgagggtgttagatact
tcctgtgggcaagtgttacaggtgtcaaggtcagggtgatggggtgcttcctccatgtgg
ggggacccgaacccagtgtgcagacagagccagcaggttgaggtggcctgaaagaaggcc

 1.03 Intr +   2814   2901   88  2  1   62   94    67 0.910   4.74
tcctgtgggcaagtgttacaggtgtcaaggtcagggtgatggggtgcttcctccatgtgg
ggggacccgaacccagtgtgcagacagagccagcaggttgaggtggcctgaaagaaggcc
tgggccagaggggggcctggggatcggggaaggtgatgagacggggcgcctcctccctag
GGGCAGAGGAAGGAGCTCTCGGGGCCAGAGGGAAAGCAGAGCCGGCCCTGCATGGAGGAA
AATGAATTGTACAGCAGCGCAGTCACAG
gtgagggggcgggggctgccctgctctcccctgggggctctccccagggtgaggtggaga
ggaggtgtgggctggctagctgctggccccgagtcttcctgccttgtggttatccccagc
ctgggccagccccgttatcagcctctccttctcgcttccgggtgcagcccaacgtaggga

 1.04 Intr +   3945   4129  185  1  2  108  113   157 0.984  20.23
ttggggagtatgacctggcacagagcagctcagcctccaagacccaggcagggggccata
agtgtgtggataatactttctagaaaagttctggtacgctcatttagaactgggcagtgg
tgaggcaggccagctgtttcccattaactgccttcgccttctctctcttcttctccccag
TCGGCCCCCACAAGGAATTTGCTGTGACCATGAGACCTACAGAAGCCAGTGAGAGGTGCC
ACCTGCGGGGGTCCTATACCCTCCGGGCTGGGGAGAGTGCCCTGGAGCTGTGGGGTGGGC
CCGAGCCAGGGACCCAGCTGTACGACTGGCCCTACAGGTTTCTGCGGCGCTTTGGGCGGG
ACAAG
gtgagtgggaagctgcatcagggcaggttgagagaaaggataagctacgaacaaagaggg
gtgagaagcagcgaggggatgggagagaccaggagagggagatggagtgaagcaaagaat
agagtgacaagatggcagaagtggagtagaaggaaggagaatgagaagaggtggagagac

 1.05 Term +   4871   5491  621  1  0  106   48   463 0.906  38.93
taccagggaggctgaggcaggagaatcgcttgaacctgggaggcggaggttgcagtgagc
tgagattgtgccactgcactccagcctggagacacagtgagactctgtctccaaaaaaaa
aaaaaaaaatgcacccctgccctgtggcctggccaataacctgctttctccctggtccag
GTAACCTTTTCCTTTGAGGCAGGCCGTCGCTGCGTCTCTGGAGAGGGCAACTTTGAGTTC
GAAACCCGGCAAGGCAATGAGATCTTCTTGGCCCTGGAAGAGGCCATCTCTGCCCAGAAG
AATGCTGCACCCGCTACACCCCAACCGCAGCCAGCCACAATCCCCGCGTCGCTGCCCCGG
CCTGATAGCCCCTACTCTCGGCCGCATGACTCACTGCCGCCGCCTTCACCCACCACACCG
GTGCCTGCTCCACGGCCTCGGGGCCAGGAGGGGGAGTATGCCGTGCCCTTCGATGCGGTG
GCCCGTTCCTTGGGGAAGAACTTCAGGGGCATCTTGGCAGTCCCTCCTCAGCTCCTGGCC
GACCCTCTGTACGACAGCATTGAGGAGACCCTGCCCCCTCGACCTGACCACATATACGAT
GAGCCCGAGGGAGTGGCTGCCCTGTCCCTCTATGACAGCCCGCAGGAGCCCCGGGGTGAG
GCATGGAGGAGGCAGGCGACAGCTGACAGGGACCCTGCTGGCCTCCAGCATGTCCAGCCA
GCCGGGCAGGATTTCTCTGCTTCTGGCTGGCAGCCAGGAACTGAGTATGACAATGTTGTA
CTAAAGAAAGGCCCAAAGTGA
cagaggcagcagagggatggtccaccgccccttggcttctgctggtgactcctcctggcc
actgcatcagaagaacctcctctgccccttctggagcccgaggcctggcctgtcttcgtt
ggggctgataaattgcctctcccagggcctgctgggtgagtcaccatcccaaagcaggaa

Predicted peptide sequence(s):


>DOK2_1|GENSCAN_predicted_peptide_1|412_aa
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKE
LSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALE
LWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEE
AISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSP
QEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK